close all open/close all

CDS information : Nogl_00160


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction16,679 / 15,381 / - [in whole cluster]
4,042 / 2,744 / - [in contig]
Locationcomplement(15381..16679) [in whole cluster]
complement(2744..4042) [in contig]
TypeCDS
Length1,299 bp (432 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)putative glycosyl transferase
Gene
Gene (GenBank)snogE
EC number
Keyword
  • C-7 OH group
  • nogalose
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[22120896] Identification of late-stage glycosylation steps in the biosynthetic pathway of the anthracycline nogalamycin. (Chembiochem. , 2012)
Related Reference
ACC
Q2P9Y9
NITE
Stref_00260
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
[18224649] Glycosylated derivatives of steffimycin: insights into the role of the sugar moieties for the biological activity. (Chembiochem. , 2008)
ACC
Q2PZR4
NITE
Cosmo_00120
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
ACC
Q9L4U6
NITE
Acla_00210
PmId
[15911373] AknT is an activating protein for the glycosyltransferase AknS in L-aminodeoxysugar transfer to the aglycone of aclacinomycin A. (Chem Biol. , 2005)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>glycosyltransferase [putative glycosyl transferase]
MRVLLTSFAMDAHFCTAVPLAWALRSAGHEVRVAGQPALTSTITGAGLTAVPVGRDHTHG
SLLGRVGSDILALHDEADYLEARHDALGFEFLKGHNTVMSALFYSQINNDSMVDDLVDFA
RHWRPDLVVWEPFTFAGAVAARASGAAHARLLSFPDLFLSTRRLFLERMARQEPEHHDDT
LAEWLDWTLGRHGHSFDEEIVTGQWSIDQTPAPVRLDAGGPTVPMRYVPYSGLVPTVVPD
WLRRPPERPRVLVTLGITSRRVKSFLAVSVDDLFEAVAGLGVEVVATLDADQRELLGRVP
DHFRIVEHVPLDAVLPTCSAIVHHGGAGTWSTAAVYGVPQVSLGSMWDHFYRARRLEELG
AGLRLPSGELTAEGLRTRLERVLGEPSFGTAAQALSDTIAAEPSPSEVVPVLEELTGRHR
PGTREPFRALRA
selected fasta
>glycosyltransferase [putative glycosyl transferase]
GTGCGCGTACTGCTGACGTCCTTCGCCATGGACGCCCACTTCTGCACCGCCGTGCCGCTG
GCGTGGGCACTGCGGTCGGCCGGGCACGAGGTACGGGTGGCCGGCCAGCCCGCGCTCACC
TCCACCATCACGGGAGCCGGCCTGACCGCCGTGCCGGTCGGCCGCGACCACACGCACGGC
AGCCTCCTGGGCCGGGTCGGCAGCGACATCCTCGCCCTGCACGACGAGGCGGACTACCTG
GAGGCCCGTCACGACGCCCTGGGCTTCGAGTTCCTCAAAGGGCACAACACGGTGATGTCC
GCGTTGTTCTACTCGCAGATCAACAACGACTCGATGGTCGACGACCTGGTGGACTTCGCC
CGTCACTGGCGGCCCGACCTGGTCGTCTGGGAGCCGTTCACCTTCGCGGGCGCCGTGGCC
GCGCGGGCCTCGGGCGCCGCCCACGCCCGCCTGCTGTCCTTCCCCGACCTGTTCCTCAGC
ACGCGCCGCCTCTTCCTGGAGCGCATGGCGCGCCAGGAGCCCGAGCATCACGACGACACA
CTCGCCGAATGGCTCGACTGGACCCTTGGCCGGCACGGCCACTCCTTCGACGAGGAGATC
GTCACGGGGCAGTGGTCCATCGACCAGACCCCCGCCCCCGTGCGGCTCGACGCCGGCGGT
CCCACCGTGCCGATGCGGTACGTCCCCTACAGCGGACTGGTGCCCACAGTGGTGCCCGAC
TGGCTGCGCAGGCCGCCCGAGCGGCCACGGGTCCTGGTCACCCTCGGCATCACCTCACGG
CGGGTGAAGTCCTTCCTCGCCGTCTCCGTGGACGACCTTTTCGAGGCCGTGGCCGGGCTC
GGCGTCGAGGTGGTCGCCACCCTCGACGCCGACCAGCGGGAGCTGCTGGGGCGCGTGCCG
GACCACTTCCGCATCGTCGAGCACGTGCCGCTGGACGCCGTTCTGCCGACCTGCTCGGCG
ATCGTCCACCACGGCGGAGCCGGCACCTGGTCGACGGCCGCCGTGTACGGGGTGCCGCAG
GTCTCCCTGGGCTCGATGTGGGACCACTTCTACCGGGCCCGTCGCCTGGAGGAACTCGGG
GCGGGGCTGCGGCTGCCCTCCGGCGAGCTGACTGCCGAGGGGCTGCGCACCCGGCTGGAG
AGGGTGCTCGGCGAGCCCTCCTTCGGCACCGCCGCGCAGGCGCTGAGCGACACCATCGCG
GCGGAACCCAGCCCCAGCGAGGTCGTGCCGGTCCTGGAGGAGCTGACCGGACGGCACCGT
CCCGGCACCCGGGAGCCGTTCCGGGCGCTGCGCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-125]  1.9e-11 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [207-304]  7.4e-31 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.408 Signal
Bacteria, Gram-positive   
 [1-23]  0.447 Signal
Bacteria, Gram-negative   
 [1-17]  0.97 Signal
Eukaryota   
TMHMM No significant hit