close all open/close all

CDS information : Nogl_00170


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction17,550 / 16,723 / - [in whole cluster]
4,913 / 4,086 / - [in contig]
Locationcomplement(16723..17550) [in whole cluster]
complement(4086..4913) [in contig]
TypeCDS
Length828 bp (275 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductNAD(P)H--quinone oxidoreductase
Product (GenBank)putative hydroxylase
Gene
Gene (GenBank)snoaW
EC number
Keyword
  • two-component system
  • C-1 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[22633406] SnoaW/SnoaL2: a different two-component monooxygenase. (Chem Biol. , 2012)
[22633415] Discovery of a two-component monooxygenase SnoaW/SnoaL2 involved in nogalamycin biosynthesis. (Chem Biol. , 2012)

close this sectionSequence

selected fasta
>NAD(P)H--quinone oxidoreductase [putative hydroxylase]
MTVLVTGATGNVGRHVVTGLLAAGRRVRALTRTPDRSGLPGGAEITGGDLTRPETYERML
DGVEAVYLFPVPETAAAFAGAARRAGVRRIVVLSSDSVTDGTDTGGHRRVELAVEDTGLE
WTHVRPGEFALNKVTLWAPSIRAEGVVRSAYPDARVAPVHEADVAAVAVTALLKEGHAGR
AYSVTGPQALTQREQVRAVGEGLGRSLAFVEVTPGQARADLTAQGLPAPIADYVLAFQAG
WTERPAPARPTVREVTGRPARTLAQWAADHRADFR
selected fasta
>NAD(P)H--quinone oxidoreductase [putative hydroxylase]
ATGACAGTATTGGTAACCGGAGCCACAGGAAACGTCGGCCGGCACGTCGTCACCGGGCTA
CTGGCCGCCGGCCGCCGGGTGCGGGCGCTGACCCGCACACCCGACCGGTCCGGCCTGCCC
GGCGGCGCGGAGATCACAGGCGGCGACCTGACCCGCCCGGAGACCTACGAGCGGATGCTG
GACGGTGTCGAAGCCGTCTACCTGTTCCCCGTCCCGGAGACCGCCGCGGCGTTCGCCGGG
GCCGCGCGACGGGCCGGTGTCCGGCGGATCGTGGTGCTCTCCTCGGACTCCGTCACCGAC
GGCACCGACACCGGAGGACACCGGCGCGTGGAACTGGCCGTGGAGGACACGGGGCTCGAG
TGGACCCATGTGCGCCCCGGCGAGTTCGCGCTCAACAAGGTCACCCTGTGGGCGCCGTCG
ATCCGCGCGGAGGGCGTCGTCCGGTCCGCGTATCCGGACGCCCGGGTGGCCCCGGTGCAC
GAGGCCGACGTCGCGGCCGTCGCGGTGACCGCGCTGCTGAAGGAGGGGCACGCCGGCCGC
GCCTACAGCGTGACCGGACCGCAGGCCCTCACCCAGCGCGAACAGGTCCGCGCGGTAGGG
GAGGGGCTCGGCCGGTCCCTCGCCTTCGTCGAGGTGACCCCCGGGCAGGCGCGGGCCGAC
CTGACCGCCCAGGGGCTGCCCGCGCCCATCGCCGACTACGTCCTCGCCTTCCAAGCCGGG
TGGACCGAGCGGCCCGCCCCCGCCCGGCCGACCGTGCGGGAGGTCACCGGCCGGCCCGCC
CGCACGCTCGCCCAGTGGGCCGCCGACCACCGAGCGGACTTCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [1-206]  3.99999999999998e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit