close all open/close all

CDS information : Nogl_00180


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction17,690 / 18,862 / + [in whole cluster]
5,053 / 6,225 / + [in contig]
Location17690..18862 [in whole cluster]
5053..6225 [in contig]
TypeCDS
Length1,173 bp (390 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)putative glycosyl transferase
Gene
Gene (GenBank)snogD
EC number
Keyword
  • C-1 OH group
  • nogalamine
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[22120896] Identification of late-stage glycosylation steps in the biosynthetic pathway of the anthracycline nogalamycin. (Chembiochem. , 2012)
[22804797] Crystal structure of the glycosyltransferase SnogD from the biosynthetic pathway of nogalamycin in Streptomyces nogalater. (FEBS J. , 2012)
Related Reference
ACC
C4NCL8
PmId
[20418426] Formation and attachment of the deoxysugar moiety and assembly of the gene cluster for caprazamycin biosynthesis. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>glycosyltransferase [putative glycosyl transferase]
MRVPGSCRTGGIMRALFITSPGLSHILPTVPLAQALRALGHEVRYATGGDIRAVAEAGLC
AVDVSPGVNYAKLFVPDDTDVTDPMHSEGLGEGFFAEMFARVSAVAVDGALRTARSWRPD
LVVHTPTQGAGPLTAAALQLPCVELPLGPADSEPGLGALIRRAMSKDYERHGVTGEPTGS
VRLTTTPPSVEALLPEDRRSPGAWPMRYVPYNGGAVLPDWLPPAAGRRRIAVTLGSIDAL
SGGIAKLAPLFSEVADVDAEFVLTLGGGDLALLGELPANVRVVEWIPLGALLETCDAIIH
HGGSGTLLTALAAGVPQCVIPHGSYQDTNRDVLTGLGIGFDAEAGSLGAEQCRRLLDDAG
LREAALRVRQEMSEMPPPAETAAKLVALAG
selected fasta
>glycosyltransferase [putative glycosyl transferase]
ATGCGTGTTCCAGGTTCATGTCGAACAGGGGGCATCATGCGTGCGTTGTTCATCACTTCA
CCCGGGCTCAGCCACATCCTGCCGACGGTGCCGCTGGCACAGGCGCTGCGCGCTCTCGGC
CACGAGGTCCGCTACGCCACGGGGGGCGACATCCGCGCCGTCGCGGAGGCCGGGCTGTGC
GCCGTGGACGTGTCGCCCGGCGTGAACTACGCGAAGCTGTTCGTGCCCGACGACACCGAC
GTCACCGACCCGATGCACTCCGAGGGGCTGGGCGAGGGCTTCTTCGCCGAGATGTTCGCC
CGGGTATCGGCGGTGGCCGTCGACGGGGCGCTGCGGACGGCGCGGAGCTGGCGGCCCGAC
CTCGTCGTGCACACTCCGACACAGGGCGCGGGCCCGCTGACGGCGGCAGCGCTGCAACTG
CCGTGCGTAGAGCTGCCGCTGGGTCCCGCGGACAGCGAGCCGGGGCTCGGCGCGCTCATC
CGGCGGGCGATGTCCAAGGACTACGAGCGCCACGGCGTCACCGGCGAGCCGACCGGTTCC
GTGCGGCTGACGACGACACCGCCGAGCGTGGAGGCGCTGCTGCCGGAGGACCGGCGCTCC
CCGGGTGCCTGGCCGATGCGGTACGTCCCCTACAACGGCGGAGCGGTGCTGCCGGACTGG
CTGCCGCCCGCGGCCGGCCGGCGGCGTATCGCGGTGACGCTGGGCTCCATCGACGCGCTG
TCGGGCGGCATCGCCAAGCTGGCCCCGCTGTTCTCCGAAGTGGCGGACGTGGACGCGGAG
TTCGTGCTGACCCTGGGCGGCGGCGACCTGGCCCTGCTCGGTGAACTGCCCGCGAACGTA
CGGGTGGTGGAGTGGATTCCGCTGGGCGCGCTGCTGGAGACGTGCGACGCGATCATCCAT
CACGGGGGCAGCGGCACACTGCTGACGGCCCTGGCCGCCGGCGTCCCGCAGTGCGTCATC
CCGCACGGCTCCTACCAGGACACCAACCGCGATGTGCTGACCGGGCTGGGCATCGGGTTC
GATGCCGAGGCGGGATCGCTGGGTGCCGAGCAGTGCCGACGGCTGCTGGACGACGCGGGG
TTGCGGGAGGCGGCCCTGCGGGTGCGGCAGGAGATGAGCGAGATGCCGCCGCCGGCCGAG
ACGGCCGCCAAGCTCGTGGCGCTGGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [24-138]  4.9e-08 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [185-281]  1.3e-26 PF06722
PF06722   DUF1205
SignalP
 [1-35]  0.652 Signal
Eukaryota   
 [1-35]  0.467 Signal
Bacteria, Gram-positive   
TMHMM No significant hit