close all open/close all

CDS information : Nogl_00190


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction19,711 / 18,908 / - [in whole cluster]
7,074 / 6,271 / - [in contig]
Locationcomplement(18908..19711) [in whole cluster]
complement(6271..7074) [in contig]
TypeCDS
Length804 bp (267 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase
Product (GenBank)SnoK
Gene
Gene (GenBank)snoK
EC number
Keyword
  • nogalamine
  • C-5'' and C-2
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[27114534] Divergent non-heme iron enzymes in the nogalamycin biosynthetic pathway. (Proc Natl Acad Sci U S A. , 2016)

close this sectionSequence

selected fasta
>cyclase [SnoK]
MPDPGGPTTAENLSKEAVRFYREQGYVHIPRVLSETEVTAFRAACEEVLEKEGREIWGAG
EDEVQVHYVAQAWQKHPELRSLVLHPEISGIALRLAGAPLRVYSSDILVKEPKRTLPTLV
HDDETGLPLNELSATLTAWIALTDVPVERGCMSYVPGSHLRAREDRQEHMTSFAEFRDLA
DVWPDYPWQPRVAVPVRAGDVVFHHCRTVHMAEANTSDSVRMAHGVVYMDADATYRPGVQ
DGHLSRLSPGDPLEGELFPLVTAGTRQ
selected fasta
>cyclase [SnoK]
ATGCCGGATCCCGGCGGCCCGACCACGGCCGAGAACCTGTCGAAGGAGGCTGTCCGCTTC
TACCGCGAGCAGGGTTACGTGCACATCCCGCGCGTCCTGTCGGAGACGGAGGTGACCGCC
TTCCGGGCCGCCTGTGAGGAGGTCCTGGAGAAGGAGGGCCGCGAGATCTGGGGCGCGGGC
GAGGACGAGGTGCAGGTCCACTACGTCGCCCAGGCCTGGCAGAAGCACCCGGAGTTGCGC
TCCCTCGTGCTGCACCCGGAGATCTCCGGCATCGCCCTGCGGCTGGCCGGCGCGCCCCTG
CGGGTCTACAGCAGCGACATCCTGGTCAAGGAGCCCAAGCGCACCCTGCCCACCCTGGTC
CACGACGACGAGACGGGACTGCCGCTGAACGAGCTGAGTGCCACGCTGACGGCCTGGATC
GCGCTGACGGACGTACCCGTCGAACGCGGCTGCATGAGCTACGTGCCGGGCTCCCATCTC
AGGGCCCGCGAGGACCGGCAGGAGCACATGACCAGCTTCGCCGAGTTCCGGGACCTCGCG
GACGTGTGGCCCGATTACCCGTGGCAGCCGCGCGTCGCCGTGCCCGTCCGCGCCGGAGAC
GTCGTGTTCCACCATTGCCGTACCGTCCACATGGCCGAAGCCAACACCAGCGACTCGGTC
CGCATGGCGCATGGCGTCGTCTACATGGACGCGGACGCCACCTACCGGCCGGGCGTCCAG
GACGGCCACCTGTCCCGCCTGTCGCCGGGAGATCCACTCGAAGGCGAGCTGTTCCCCCTG
GTCACGGCAGGCACACGGCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008775 Phytanoyl-CoA dioxygenase (Family)
 [21-223]  2.19999999999997e-45 PF05721
PF05721   PhyH
SignalP No significant hit
TMHMM No significant hit