close all open/close all

CDS information : Nogl_00200


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction20,196 / 19,762 / - [in whole cluster]
7,559 / 7,125 / - [in contig]
Locationcomplement(19762..20196) [in whole cluster]
complement(7125..7559) [in contig]
TypeCDS
Length435 bp (144 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productnogalonic acid methyl ester cyclase
Product (GenBank)nogalonic acid methyl ester cyclase
Gene
Gene (GenBank)snoaL
EC number
Keyword
  • 4th ring
  • C-9 S-stereochemistry
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[10639368] Identification of a cyclase gene dictating the C-9 stereochemistry of anthracyclines from Streptomyces nogalater. (Antimicrob Agents Chemother. , 2000)
[15071504] Structure of the polyketide cyclase SnoaL reveals a novel mechanism for enzymatic aldol condensation. (EMBO J. , 2004)
[16414075] Crystal structure of the polyketide cyclase AknH with bound substrate and product analogue: implications for catalytic mechanism and product stereoselectivity. (J Mol Biol. , 2006)

close this sectionSequence

selected fasta
>nogalonic acid methyl ester cyclase [nogalonic acid methyl ester cyclase]
MSRQTEIVRRMVSAFNTGRTDDVDEYIHPDYLNPATLEHGIHTGPKAFAQLVGWVRATFS
EEARLEEVRIEERGPWVKAYLVLYGRHVGRLVGMPPTDRRFSGEQVHLMRIVDGKIRDHR
DWPDFQGTLRQLGDPWPDDEGWRP
selected fasta
>nogalonic acid methyl ester cyclase [nogalonic acid methyl ester cyclase]
TTGAGCCGTCAGACAGAGATCGTCCGCCGGATGGTGAGCGCCTTCAACACCGGCAGGACC
GACGACGTGGACGAGTACATCCACCCCGACTACCTCAATCCGGCCACCTTGGAACACGGC
ATCCACACCGGGCCCAAGGCGTTCGCCCAGCTGGTCGGCTGGGTGCGGGCGACGTTCTCC
GAGGAAGCCCGCCTGGAGGAGGTGCGGATCGAGGAGCGCGGCCCGTGGGTCAAGGCCTAC
CTCGTGCTCTACGGCCGCCACGTCGGCCGGCTTGTCGGTATGCCGCCCACCGACCGGCGC
TTCTCCGGTGAACAGGTGCACCTGATGCGCATCGTCGACGGGAAGATCCGCGACCACCGG
GACTGGCCCGACTTCCAGGGGACGCTGCGCCAGCTCGGCGACCCGTGGCCCGACGACGAG
GGCTGGCGTCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [6-132]  5.7e-31 PF07366
PF07366   SnoaL
SignalP No significant hit
TMHMM No significant hit