close all open/close all

CDS information : Nogl_00210


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction20,406 / 21,458 / + [in whole cluster]
7,769 / 8,821 / + [in contig]
Location20406..21458 [in whole cluster]
7769..8821 [in contig]
TypeCDS
Length1,053 bp (350 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)putative dTDP-glucose-4,6-dehydratase
Gene
Gene (GenBank)snogK
EC number4.2.1.46
Keyword
  • nogalamine
  • nogalose
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
Q194R3
NITE
Mith_00070
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative dTDP-glucose-4,6-dehydratase]
MASHTSATTDVNILVTGAVGFIGSAYVRMLLENRAPGAGAPAVRVTVLDKLTYAGNLTNL
DAVRGDRLRFVRGDILDAELVDELMAHSDQVVHFAAESHVDRSIRAADDFVLTNVVGTQR
LLDAALRHGVEPFVLVSTDEVYGSIASGSWPEEHPLSPNSPYAASKASADLMAFACHRTH
GLDVRVTRCSNNYGPRQHPEKLIPRFVTNLLDGLPVPLYGDGRNVREWLHVEDHCRGVDL
VRTAGRPGGVYHIGGGRELSNRELVGMLLELCGADWSSVRHVPDRKGHDLRYSLDWGRAR
EELGYRPAREFSSGLRSTVQWYRENRSWWEPLKRGVTAPGGTSTVVPGVR
selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative dTDP-glucose-4,6-dehydratase]
ATGGCGTCGCACACCTCCGCGACGACGGACGTGAACATCCTGGTCACCGGCGCGGTCGGT
TTCATCGGCTCGGCCTATGTGCGCATGCTGCTGGAGAACCGGGCCCCCGGAGCGGGGGCC
CCGGCGGTACGCGTCACCGTCCTCGACAAACTGACGTACGCGGGCAACCTCACGAACCTG
GACGCGGTACGCGGTGACCGGCTGCGCTTCGTGCGGGGCGACATCCTCGACGCCGAGCTG
GTCGACGAGCTGATGGCACACAGCGACCAGGTCGTCCACTTCGCCGCGGAGTCGCACGTC
GACCGGTCCATCCGCGCGGCCGACGACTTCGTGCTGACCAACGTCGTCGGCACCCAGCGG
CTGCTGGACGCCGCGCTGCGCCACGGCGTGGAGCCCTTCGTCCTGGTGTCCACGGACGAG
GTCTACGGCTCCATCGCGTCCGGTTCCTGGCCGGAGGAGCACCCGCTGAGCCCCAACTCC
CCGTACGCCGCCTCCAAGGCGTCGGCCGACCTGATGGCGTTCGCCTGCCACCGCACGCAC
GGCCTGGACGTGCGGGTGACCCGCTGTTCCAACAACTACGGCCCGCGTCAGCACCCGGAG
AAGCTCATCCCGCGCTTCGTCACCAACTTGTTGGACGGGCTGCCGGTGCCGCTGTACGGG
GACGGGCGGAACGTGCGGGAGTGGCTGCACGTGGAGGACCACTGCCGGGGCGTGGACCTG
GTGCGCACCGCGGGCCGGCCCGGCGGTGTGTACCACATCGGCGGCGGCCGGGAGCTCTCC
AACCGGGAGCTGGTGGGTATGTTGCTGGAGCTGTGCGGGGCGGACTGGAGCAGCGTCCGG
CACGTGCCCGACCGCAAGGGGCACGACCTGCGTTACAGCCTGGACTGGGGCAGGGCCCGT
GAGGAACTGGGCTACCGTCCGGCGCGGGAGTTCTCCTCGGGGCTGCGCTCGACGGTCCAG
TGGTACCGCGAGAACCGGTCCTGGTGGGAGCCGCTCAAGCGGGGAGTCACGGCGCCGGGC
GGTACGTCCACCGTCGTCCCCGGGGTCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [13-254]  1.29999999999998e-63 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [12-332]  3.99999999999998e-120 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [12-210]  1.40000000000001e-64 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM
 [13-30]  Transmembrane (i-o)
Transmembrane 1