close all open/close all

CDS information : Nogl_00220


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction21,464 / 22,369 / + [in whole cluster]
8,827 / 9,732 / + [in contig]
Location21464..22369 [in whole cluster]
8827..9732 [in contig]
TypeCDS
Length906 bp (301 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)putative dTDP-4-dehydrorhamnose reductase
Gene
Gene (GenBank)snogC
EC number
Keyword
  • S-stereochemistry
  • nogalose
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
Q93F84
PmId
[12147463] Homologs of the Rml enzymes from Salmonella enterica are responsible for dTDP-beta-L-rhamnose biosynthesis in the gram-positive thermophile Aneurinibacillus thermoaerophilus DSM 10155. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [putative dTDP-4-dehydrorhamnose reductase]
MRVLVTGGEGMLARHLTAALAETGRSRPAAEAVVLGRRALDITDGRAVDAAFAAHRPRVV
VNCAAFTDVDGAESRWAEAMRVNGGGPRLLARRCARHGVRLIHVSTDYVFPGDTRSPYGE
SDAPGPRTVYGRSKLAGERAVLSLLPDTGTVVRTAWLYGGQGRSFVRTMLERAPDDGHVD
VVNDQWGQPTWAGDVARLLVTLARTPPDRARGIFHATNAGAATWYELAREVFRLAGADPE
RVRPVATADRPGPAPRPACTVLGHDRWRLVGVAPPRDWRAALREAMRQLLPGGRLRNLTG
T
selected fasta
>putative NDP-hexose C-4 ketoreductase [putative dTDP-4-dehydrorhamnose reductase]
ATGCGCGTGCTGGTCACCGGAGGAGAAGGCATGCTCGCCCGGCACCTGACCGCGGCCCTG
GCGGAGACCGGCAGGAGCCGGCCCGCCGCCGAGGCGGTGGTACTCGGGCGGCGCGCGCTG
GACATCACCGACGGGCGGGCGGTGGACGCCGCGTTCGCCGCGCACCGGCCGCGGGTGGTG
GTCAACTGCGCCGCCTTCACGGACGTGGACGGCGCCGAGTCGCGGTGGGCGGAGGCGATG
CGCGTCAACGGCGGCGGGCCCCGGCTGCTGGCCCGCCGCTGTGCGCGCCACGGCGTACGG
CTGATCCACGTCTCGACCGACTACGTCTTCCCGGGCGACACCCGCAGCCCTTACGGCGAG
TCGGACGCTCCGGGCCCGCGCACGGTGTACGGCCGCAGCAAACTGGCCGGGGAACGGGCC
GTGCTGTCGCTGCTGCCGGATACGGGCACCGTGGTGCGCACGGCGTGGCTCTACGGCGGG
CAGGGCCGCAGCTTCGTGCGCACGATGCTGGAGCGTGCCCCGGACGACGGCCATGTCGAC
GTCGTCAACGACCAGTGGGGGCAGCCGACGTGGGCCGGTGACGTGGCCCGGCTGCTGGTG
ACGCTGGCCCGCACGCCGCCAGACCGGGCGCGCGGGATCTTCCACGCCACCAACGCCGGG
GCGGCCACCTGGTACGAGCTGGCCCGGGAGGTGTTCCGGCTGGCGGGCGCGGACCCGGAA
CGGGTGCGCCCGGTGGCGACGGCCGACCGGCCGGGCCCGGCGCCCCGGCCGGCGTGCACG
GTGCTCGGGCACGACCGCTGGCGGCTGGTCGGCGTCGCACCGCCCCGCGACTGGCGTGCA
GCCCTGCGCGAGGCGATGCGTCAGCTGCTGCCCGGCGGGCGCCTCAGGAACCTGACGGGG
ACGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005913 dTDP-4-dehydrorhamnose reductase (Family)
 [2-288]  5.4e-88 TIGR01214
TIGR01214   rmlD: dTDP-4-dehydrorhamnose reductase
 [1-289]  4.2e-102 PF04321
PF04321   RmlD_sub_bind
IPR016040 NAD(P)-binding domain (Domain)
 [1-236]  1.2e-57 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-21]  0.159 Signal
Bacteria, Gram-positive   
TMHMM No significant hit