close all open/close all

CDS information : Nogl_00230


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction23,615 / 22,347 / - [in whole cluster]
10,978 / 9,710 / - [in contig]
Locationcomplement(22347..23615) [in whole cluster]
complement(9710..10978) [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 C-methyltransferase
Product (GenBank)SnoG
GenesnogG2
Gene (GenBank)snoG
EC number2.1.1.-
Keyword
  • nogalose
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
Q194Q4
NITE
Mith_00210
PmId
[11254130] The mtmVUC genes of the mithramycin gene cluster in Streptomyces argillaceus are involved in the biosynthesis of the sugar moieties. (Mol Gen Genet. , 2001)
[11853433] Ketopremithramycins and ketomithramycins, four new aureolic acid-type compounds obtained upon inactivation of two genes involved in the biosynthesis of the deoxysugar moieties of the antitumor drug mithramycin by Streptomyces argillaceus, reveal novel insights into post-PKS tailoring steps of the mithramycin biosynthetic pathway. (J Am Chem Soc. , 2002)
[21960454] Investigating Mithramycin deoxysugar biosynthesis: enzymatic total synthesis of TDP-D-olivose. (Chembiochem. , 2011)
[22997042] Cooperation of two bifunctional enzymes in the biosynthesis and attachment of deoxysugars of the antitumor antibiotic mithramycin. (Angew Chem Int Ed Engl. , 2012)
ACC
P96561
NITE
Chlor_00150
PmId
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 C-methyltransferase [SnoG]
MDNRETVRPVSVCRVCGGNDWQDVVDFGDVPLANGFLSPADSYENERRYPLGVLSCRACR
LMSLTHVVDPEVLYRDYAYTTPDSEMITQHMRHITALCRTRFELPPDSLVVELGSNTGRQ
LMAFREAGMRTLGVDPARNLTDVARRNGIETFPDFFSHDVARTIRRDHGQARLVLGRHVF
AHIDDVSDIAAGVRELLSPDGVFAIEVPYVLDLLEKVAFDTIYHEHLSYFTMRSFVTLFA
RHGLRVLDVERFGVHGGSVLVFVGHEDGPWPERPSVPELLRVERQRGLYDDATYRTFAQR
IERVRTELPELLRSLVAQGKRIVGYGAPAKGNTILTVCGLGLKELEYCTDTTELKQGRVL
PGTHIPVHAPEHAKEHIPDYYLLLAWNYATEILDKETAFRDNGGRFIVPIPRPSILTSPS
GS
selected fasta
>putative NDP-hexose C-3 C-methyltransferase [SnoG]
ATGGACAACCGCGAGACCGTACGACCGGTGAGCGTCTGCCGGGTCTGCGGCGGCAACGAC
TGGCAGGACGTCGTGGACTTCGGTGACGTTCCCCTCGCCAACGGCTTCCTGTCCCCGGCC
GACTCCTACGAGAACGAGCGCCGCTACCCGCTGGGCGTCCTGTCCTGCCGCGCCTGCCGG
CTGATGAGCCTGACCCACGTGGTCGACCCCGAGGTGCTGTACCGCGACTACGCCTACACC
ACCCCCGACTCCGAAATGATCACCCAGCACATGCGGCACATCACCGCGCTGTGCCGCACC
CGTTTCGAGCTTCCCCCGGACAGCCTCGTCGTGGAGCTGGGCAGCAATACCGGCCGTCAG
CTCATGGCCTTCCGCGAAGCGGGGATGCGCACCCTGGGCGTGGACCCCGCGCGCAACCTC
ACGGACGTCGCCCGGCGCAACGGCATCGAGACCTTCCCCGACTTCTTCTCCCACGACGTG
GCCCGCACCATCCGGCGCGACCACGGGCAGGCGCGGCTCGTGCTGGGACGGCATGTCTTC
GCCCACATCGACGACGTGTCGGACATCGCGGCCGGCGTACGCGAACTCCTGTCTCCCGAC
GGGGTGTTCGCGATCGAGGTGCCGTACGTTCTGGACCTGCTGGAGAAGGTCGCGTTCGAC
ACCATCTACCACGAGCACTTGTCGTACTTCACCATGCGGTCCTTCGTCACCCTCTTCGCG
CGCCACGGGCTGCGGGTGCTCGACGTGGAGCGGTTCGGCGTGCACGGCGGATCGGTCCTC
GTCTTCGTGGGCCACGAGGACGGCCCCTGGCCCGAACGTCCCTCCGTCCCCGAACTGCTG
CGCGTGGAACGGCAGCGGGGCCTCTACGACGACGCCACCTACCGCACGTTCGCGCAGCGG
ATCGAGCGGGTGCGCACCGAACTGCCGGAACTGCTGCGCTCCCTCGTGGCCCAGGGCAAG
CGCATCGTCGGCTACGGTGCTCCGGCCAAGGGCAACACCATCCTCACGGTGTGCGGGCTC
GGCCTGAAGGAGCTGGAATACTGCACCGACACCACCGAGCTGAAGCAGGGCAGGGTGCTG
CCCGGCACCCACATACCGGTGCACGCTCCCGAGCACGCCAAGGAACACATCCCCGACTAC
TACCTGTTGCTCGCCTGGAACTACGCCACGGAGATCCTCGACAAGGAGACGGCCTTCCGG
GACAACGGCGGCCGGTTCATCGTGCCCATCCCCCGCCCGTCGATCCTCACGTCCCCGTCA
GGTTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013630 Methyltransferase putative zinc binding domain (Domain)
 [13-75]  2.80000000000001e-23 PF08421
PF08421   Methyltransf_13
IPR013691 C-methyltransferase (Domain)
 [253-411]  4.5e-60 PF08484
PF08484   Methyltransf_14
SignalP No significant hit
TMHMM No significant hit