close all open/close all

CDS information : Nogl_00240


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction24,904 / 23,678 / - [in whole cluster]
12,267 / 11,041 / - [in contig]
Locationcomplement(23678..24904) [in whole cluster]
complement(11041..12267) [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase helper protein
Product (GenBank)SnogN
Gene
Gene (GenBank)snogN
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
Q9L4U5
NITE
Acla_00220
PmId
[15911373] AknT is an activating protein for the glycosyltransferase AknS in L-aminodeoxysugar transfer to the aglycone of aclacinomycin A. (Chem Biol. , 2005)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative glycosyltransferase helper protein [SnogN]
MVMKLTDSELGRALLSLRGYQWLRGIHHDPYALLLRAESDDPAQLGRLLRERGRLHRSDT
GTWVTADHATASRLLADPRFVLRRPPAGPATGTGDVMPWEEATLSDLLPLDEARLTTDRA
RCRRLGATAARIAADGPVATRLADLAGARAEQVRSTGHFDLRADYALPYAVEAACALLGL
PAGQCSLFGAFSPAVLLDATVVPPRLPEARALIASTAELTALWPRLAPSLSKTVPEDEAP
DLFLLTAVLLVPAVVHLVCEAVAALSHDPGQAGLLRDDPVLAAPAVEETLRHAPPARLFT
LHATGPERVADVDLPAGAEVAVVVAAAHRDPSWCPDPDRFDLTRNERHLALPPDLPLGAL
APLLRVCATAAVAALAAGLLPLRAVGPPVRRLRAPVTRSVLRFPVAPC
selected fasta
>putative glycosyltransferase helper protein [SnogN]
ATGGTGATGAAACTGACGGACAGCGAGCTGGGGCGTGCGCTGCTCTCGCTGCGTGGTTAC
CAGTGGCTCCGCGGCATCCACCACGATCCCTACGCCCTGCTGCTGCGCGCCGAGAGCGAC
GATCCGGCGCAGCTCGGCCGGCTGCTGCGTGAACGCGGCCGGCTCCACCGCAGCGACACC
GGCACCTGGGTCACCGCGGACCATGCGACGGCCTCCCGGCTGCTCGCCGACCCGCGCTTC
GTGCTGCGCCGCCCGCCGGCCGGGCCCGCCACCGGCACCGGGGACGTCATGCCGTGGGAA
GAGGCCACGCTGAGCGACCTGCTGCCCCTCGACGAGGCGCGCCTGACGACCGACCGGGCA
CGGTGCCGCCGGCTCGGCGCGACCGCCGCGCGGATCGCGGCGGACGGTCCCGTCGCGACG
CGACTCGCGGACCTGGCCGGGGCCCGAGCCGAACAGGTGCGCTCAACGGGCCACTTCGAC
CTCAGGGCCGACTACGCCCTCCCGTACGCGGTCGAGGCGGCCTGCGCGCTGCTCGGCCTG
CCGGCCGGGCAGTGTTCCCTCTTCGGCGCCTTCTCCCCGGCCGTCCTGCTCGACGCGACG
GTCGTACCGCCCCGCCTTCCGGAGGCGCGCGCCCTGATCGCCTCCACGGCGGAACTGACC
GCCCTCTGGCCGCGGCTGGCCCCGAGCCTGTCGAAGACCGTCCCGGAGGACGAAGCGCCG
GACCTCTTCCTGCTGACGGCCGTGTTACTCGTACCGGCCGTCGTCCACCTGGTCTGCGAG
GCGGTCGCCGCCCTGTCGCACGACCCCGGGCAGGCCGGGCTGCTCAGGGACGACCCGGTA
CTCGCCGCACCGGCGGTCGAGGAGACGCTGCGCCACGCACCGCCCGCCCGTCTGTTCACC
CTCCACGCGACCGGACCGGAGCGCGTCGCGGACGTCGACCTCCCCGCGGGCGCCGAGGTC
GCCGTCGTCGTGGCGGCGGCGCACCGCGATCCCTCCTGGTGCCCGGACCCCGACCGCTTC
GACCTCACCAGGAACGAGCGGCATCTGGCACTGCCGCCGGATCTGCCGCTGGGGGCGCTC
GCCCCGCTGCTGCGCGTCTGCGCGACCGCGGCCGTCGCGGCCCTCGCGGCCGGACTCCTC
CCGCTGCGGGCCGTCGGCCCGCCCGTACGACGGCTGCGTGCCCCGGTCACCCGGTCCGTG
CTGCGCTTCCCCGTCGCCCCGTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [285-344]  1.1e-06 PF00067
PF00067   p450
 [29-344]  2.60000517657733e-27 SSF48264
SSF48264   Cytochrome_P450
 [31-348]  1.2e-30 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
SignalP No significant hit
TMHMM No significant hit