close all open/close all

CDS information : Nogl_00250


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction25,095 / 25,877 / + [in whole cluster]
12,458 / 13,240 / + [in contig]
Location25095..25877 [in whole cluster]
12458..13240 [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)putative polyketide cyclase
Gene
Gene (GenBank)snoaM
EC number
Keyword
  • 2nd and 3rd ring
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
Related Reference
ACC
Q9L4U2
NITE
Acla_00250
PmId
[12715874] Studies on a second and third ring cyclization in anthracycline biosynthesis. (J Antibiot (Tokyo). , 2003)
ACC
O68500
NITE
Adria_00160
PmId
[9573189] The Streptomyces peucetius dpsY and dnrX genes govern early and late steps of daunorubicin and doxorubicin biosynthesis. (J Bacteriol. , 1998)
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative cyclase [putative polyketide cyclase]
MRLIDLSSPVDSSQYEPDPVVHDVLTPRQGAEHMCAEMREHFGVEFSPDELPDGEFLSLD
RITLTTHTGTHVDAPSHYGSRALYGDGVPRHIDQMPLEWFFGRGVVLDLTDAPTGTVSAA
RLEKELARTGCALRPGDIVLLHTGAQRHAGTPRYFTDFAGLDGPAVRMLLDHGVRVIGTD
AFSLDAPFGHIIDRYRATGDRSVLWPAHVVGREREYCQIERLANLDRLPVSFGFRVCCFP
VKVAGAGAGWTRAVALVDED
selected fasta
>putative cyclase [putative polyketide cyclase]
GTGCGGCTCATCGACCTTTCGTCACCGGTGGATTCCTCACAGTACGAGCCCGACCCGGTG
GTGCACGACGTCCTCACGCCCCGGCAGGGCGCGGAACACATGTGCGCGGAGATGCGCGAG
CACTTCGGTGTCGAGTTCTCTCCGGACGAACTGCCGGACGGCGAGTTCCTGTCACTGGAC
AGGATCACGCTGACCACGCACACCGGCACGCACGTCGACGCGCCGTCGCACTATGGTTCG
CGCGCGCTGTACGGGGACGGCGTCCCCCGCCACATCGACCAGATGCCGCTGGAGTGGTTC
TTCGGGCGCGGGGTGGTGCTGGACCTCACCGACGCTCCGACGGGCACCGTGAGCGCCGCG
CGCCTGGAGAAGGAACTGGCCCGGACCGGGTGCGCGTTGCGGCCCGGGGACATCGTGCTG
CTGCACACCGGTGCCCAGCGGCACGCGGGCACCCCGCGCTACTTCACGGACTTCGCCGGT
CTCGACGGGCCCGCGGTACGGATGCTTCTCGACCACGGGGTCCGGGTGATCGGGACCGAT
GCCTTCAGCCTGGACGCGCCCTTCGGCCACATCATCGACCGGTACCGCGCGACCGGCGAC
CGATCGGTGCTGTGGCCCGCGCACGTGGTGGGCCGGGAGCGGGAGTACTGCCAGATCGAG
CGGCTGGCGAACCTCGACCGCCTGCCGGTCTCCTTCGGGTTCCGCGTCTGCTGCTTCCCG
GTCAAGGTCGCCGGCGCCGGCGCCGGGTGGACCCGGGCGGTCGCCCTGGTGGACGAGGAC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007325 Putative cyclase (Family)
 [4-187]  1.9e-42 PF04199
PF04199   Cyclase
SignalP No significant hit
TMHMM No significant hit