close all open/close all

CDS information : Nogl_00260


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction25,881 / 26,597 / + [in whole cluster]
13,244 / 13,960 / + [in contig]
Location25881..26597 [in whole cluster]
13244..13960 [in contig]
TypeCDS
Length717 bp (238 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose N-methyltransferase
Product (GenBank)putative amino methylase
Gene
Gene (GenBank)snogA
EC number2.1.1.-
Keyword
  • nogalamine
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
Q9ZGH6
NITE
Pikro_00100
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[12119032] Expression, purification, and characterization of two N,N-dimethyltransferases, tylM1 and desVI, involved in the biosynthesis of mycaminose and desosamine. (Biochemistry. , 2002)

close this sectionSequence

selected fasta
>putative NDP-hexose N-methyltransferase [putative amino methylase]
MYGRELADVYEMVYRSRGKSWADEAERVTAEIRSRRPGARSLLDVACGTGAHLEAFRGLF
AHTEGLELSDEMRALAERRLPGVPVRPGDMRDFALSGRFDAVVCLFCSIGYLETVADMRA
AVRTMAAHLVPGGVLVVEPWWFPERFLEGYVAGDLARGEGRTVARVSHSTRQGRRTRMEV
RFLVGEATGIREFTEIDLLTLFTREEYLAAFEDAGCPAEFLDDGLTGRGLFVGVRGAG
selected fasta
>putative NDP-hexose N-methyltransferase [putative amino methylase]
GTGTACGGCCGGGAACTGGCGGACGTGTACGAGATGGTCTACCGCAGCCGGGGAAAGAGC
TGGGCGGACGAGGCCGAACGGGTCACCGCGGAGATCAGGTCCCGTCGGCCCGGGGCGCGT
TCGCTGCTCGACGTCGCCTGCGGCACCGGCGCCCATCTGGAGGCCTTCCGCGGGCTGTTC
GCGCACACGGAGGGCCTGGAGCTGTCGGACGAGATGCGGGCCCTGGCCGAACGGCGGCTG
CCGGGGGTGCCGGTGCGGCCCGGGGACATGCGCGACTTCGCCCTGAGCGGGCGTTTCGAC
GCCGTGGTCTGCCTGTTCTGCTCCATCGGGTATCTGGAGACCGTCGCGGACATGCGGGCG
GCGGTGCGCACGATGGCCGCGCACCTGGTGCCGGGCGGCGTGCTCGTGGTGGAGCCCTGG
TGGTTCCCCGAGCGGTTCCTGGAGGGCTACGTCGCCGGGGACCTGGCACGCGGTGAGGGC
CGGACCGTGGCCCGGGTGTCCCACTCCACCAGGCAGGGCCGCAGGACCCGCATGGAGGTG
CGGTTCCTGGTCGGCGAGGCCACCGGGATACGCGAGTTCACGGAGATCGACCTGCTCACC
CTGTTCACCAGGGAGGAGTACCTCGCCGCGTTCGAGGACGCGGGCTGCCCGGCCGAGTTC
CTGGACGACGGGCTGACCGGCCGGGGGTTGTTCGTCGGGGTGCGCGGGGCCGGGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-39]  0.037 Signal
Bacteria, Gram-negative   
TMHMM No significant hit