close all open/close all

CDS information : Nogl_00270


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction27,511 / 26,630 / - [in whole cluster]
14,874 / 13,993 / - [in contig]
Locationcomplement(26630..27511) [in whole cluster]
complement(13993..14874) [in contig]
TypeCDS
Length882 bp (293 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)putative dTDP-glucose synthase
Gene
Gene (GenBank)snogJ
EC number2.7.7.24
Keyword
  • nogalamine
  • nogalose
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
Q9AGY4
PmId
[12147463] Homologs of the Rml enzymes from Salmonella enterica are responsible for dTDP-beta-L-rhamnose biosynthesis in the gram-positive thermophile Aneurinibacillus thermoaerophilus DSM 10155. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative dTDP-glucose synthase]
MKGIILAGGTGSRLHPTTLAVSKQLLPVGDKPMIYYPLSVLMLAGVTDILIISTPHELPR
MRRLFGDGAQLGLRLAYAEQEKPRGIAEAFLIGADHVGSDAVALALGDNIFHGSSFQGVL
RKEAEELDGCVLFGYPVKDPQRYGVGEANASGRLVSIEEKPVRPRSNRAITGLYFYDNEV
VDIARRLRPSARGELEITDINRTYMERGRARLVDLGRGFAWLDTGTPESLLQASQYVSAL
EERQGIRIACIEEVALRMGFINAQACYELGARLSGSGYGQYVMAIAEECTGRV
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [putative dTDP-glucose synthase]
GTGAAGGGAATCATTCTCGCCGGGGGTACGGGGAGCAGGCTCCACCCGACGACTCTCGCG
GTGTCCAAGCAGCTTCTCCCCGTCGGGGACAAGCCGATGATCTACTACCCGCTCTCCGTG
CTGATGCTGGCCGGCGTCACGGACATCCTCATCATCAGCACACCGCACGAACTCCCCCGA
ATGCGCCGTCTGTTCGGCGACGGCGCACAGCTCGGACTCCGCCTGGCCTACGCCGAGCAG
GAGAAACCCAGGGGTATCGCCGAGGCGTTCCTGATCGGTGCCGACCACGTGGGAAGCGAT
GCCGTTGCGCTGGCGCTGGGCGACAACATATTCCACGGGAGTTCTTTTCAGGGGGTGCTG
CGCAAGGAAGCCGAGGAATTGGACGGGTGTGTCCTGTTCGGTTATCCGGTCAAGGATCCC
CAGCGTTATGGAGTCGGCGAGGCGAACGCGTCCGGGCGGCTCGTCTCCATCGAGGAGAAA
CCGGTACGCCCCCGCTCCAACCGGGCCATCACCGGACTCTATTTCTACGACAACGAGGTG
GTGGACATCGCCCGGCGGCTGCGCCCCTCCGCCCGCGGCGAACTCGAAATCACCGACATC
AACCGTACCTACATGGAACGAGGCCGGGCCCGGCTCGTGGACCTGGGCCGGGGATTCGCC
TGGCTCGACACCGGCACACCCGAGTCACTCCTGCAGGCCTCGCAGTACGTGTCCGCCCTG
GAGGAACGCCAGGGCATCAGGATCGCCTGCATCGAGGAGGTGGCCCTCCGCATGGGCTTC
ATCAACGCCCAGGCCTGCTACGAACTGGGCGCGCGCCTGTCCGGCTCCGGCTACGGGCAG
TACGTGATGGCCATCGCGGAGGAGTGCACGGGGCGGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-237]  8.20000000000006e-59 PF00483
PF00483   NTP_transferase
IPR005907 Glucose-1-phosphate thymidylyltransferase, short form (Family)
 [2-286]  1.99999999999999e-125 TIGR01207
TIGR01207   RmlA
SignalP No significant hit
TMHMM No significant hit