close all open/close all

CDS information : Nogl_00280


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction27,676 / 28,701 / + [in whole cluster]
15,039 / 16,064 / + [in contig]
Location27676..28701 [in whole cluster]
15039..16064 [in contig]
TypeCDS
Length1,026 bp (341 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 aminotransferase(fragment)
Product (GenBank)putative aminotransferase
Gene
Gene (GenBank)snogI
EC number
Keyword
  • nogalamine
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
Q9F837
NITE
Megalo_00050
PmId
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 aminotransferase(fragment) [putative aminotransferase]
MTVHVWDYLPEYELEREDIHDAVETVFRSGRLVLGESVRGFESEFASFQGVGHAVGVDNG
TNAVKLGLQALGVGPGDEVVTVSNTAAPTVVAIDSAGATPVFVDVREEDYLMDTSQVEAV
LTPRTRCLLPVHLYGQCVDMAPLRDLAARHNLVILEDCAQAHGARRHGRLAGSTGDAAAF
SFYPTKVLGAYGDGGAVLTDDERVADRLRRLRYYGMESRYYVVETPGHNSRLDEVQAEIL
RRKLSRLPSYIEARRAVARRYEEGLADTGLLLPRTAQGNEHVYYVYVVRHPRRDAVLEAL
RASYDIALNISYPWPVHTMTGFSHLGYAKGSLPVTEALADEI
selected fasta
>putative NDP-hexose C-3 aminotransferase(fragment) [putative aminotransferase]
ATGACCGTACACGTGTGGGACTATCTGCCGGAATACGAGCTGGAACGCGAGGACATCCAC
GATGCCGTGGAGACGGTGTTCCGCTCCGGCCGGCTCGTCCTCGGTGAGAGCGTGCGCGGC
TTCGAGTCCGAGTTCGCCTCATTCCAGGGCGTCGGACATGCCGTCGGCGTCGACAACGGG
ACCAACGCCGTCAAGCTGGGGTTACAGGCCTTGGGTGTCGGGCCCGGCGACGAGGTCGTC
ACCGTGTCCAACACCGCCGCGCCCACGGTCGTCGCGATCGACTCGGCCGGTGCCACGCCC
GTCTTCGTGGACGTGCGCGAGGAGGACTACCTGATGGACACGTCCCAGGTGGAGGCCGTC
CTCACGCCACGCACCCGGTGTCTGCTGCCGGTCCACCTCTACGGGCAGTGCGTGGACATG
GCACCGCTGCGCGATCTGGCCGCCCGGCACAACCTGGTGATCCTGGAGGACTGCGCGCAG
GCGCACGGGGCGCGCCGGCACGGCCGACTCGCCGGCTCGACCGGTGACGCGGCCGCGTTC
TCCTTCTACCCGACCAAGGTGCTGGGCGCGTACGGGGACGGCGGCGCGGTGCTCACCGAC
GACGAGCGGGTGGCGGACCGGCTGCGGCGGCTGCGCTACTACGGCATGGAGAGCCGCTAC
TACGTCGTCGAAACCCCCGGGCACAACAGCCGGCTGGACGAAGTACAGGCAGAGATCCTG
CGGCGCAAGCTGTCCCGGTTGCCGTCCTACATCGAGGCCCGCCGGGCGGTGGCACGCCGC
TATGAGGAGGGCCTGGCGGACACGGGGCTGCTGCTGCCGAGGACCGCGCAGGGCAACGAG
CACGTCTACTACGTGTACGTGGTGCGCCATCCGCGACGGGACGCGGTGCTGGAGGCCCTG
CGCGCCTCCTACGACATCGCCCTCAACATCAGTTATCCCTGGCCCGTGCACACCATGACC
GGTTTCTCCCATCTCGGCTACGCCAAGGGCTCGTTGCCGGTCACCGAGGCACTGGCGGAC
GAGATC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-342]  2.89997807423186e-72 PIRSF000390
PIRSF000390   PLP_StrS
 [15-341]  3.10000000000005e-109 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [16-245]  7.59999999999998e-77 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [248-342]  5.40000000000002e-24 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [6-342]  1.39999277195148e-94 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit