close all open/close all

CDS information : Nogl_00290


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction30,320 / 28,854 / - [in whole cluster]
1,618 / 152 / - [in contig]
Locationcomplement(28854..30320) [in whole cluster]
complement(152..1618) [in contig]
TypeCDS
Length1,467 bp (488 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)SnogH
Gene
Gene (GenBank)snogH
EC number
Keyword
  • nogalamine
Note
Note (GenBank)
Reference
ACC
PmId
[9349712] Characterization of Streptomyces nogalater genes encoding enzymes involved in glycosylation steps in nogalamycin biosynthesis. (Mol Gen Genet. , 1997)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [SnogH]
MTKLSAHPAAPAHGAVPDPLRLAASARSAGVWLPRTTEVHHWLATVGQHARAQVERVPLA
ELDGWLRDPATGNIAHRSGGFFTVEGLDVTIPRAPVPHWEQPIINQPEVGLLGIVVKEFD
GVLHCLMQAKLEPGNCNGIQLSPTVQATRSNYTRVHRGRPVPYLEHFQDPARRSRILADV
RQSEQGSWFHHKRNRNMVVEVEEDIDVHDGFCWLSLGQLHELLTVDNLINMDTRTVLSCL
PFAHAGLAAVAAPGADPFRRALVASCAPDGYSRHSLGDLLSWITDVRTRTEVRTEMVPLD
GLRSWRRTDERISHEDGGFFDVIGVRVRTRGREVAEWTQPMIEPHAKGVVAFLVRPIEGV
LHVLVHARVEPGYVDIVELAPTVQCTPDSYERLPARARPLFLDEVLPARADRVRFDAELS
EEGGRFYHARNRYLVAETDLAAGFDHPDFRWVTLAQLVELLRHSHYVNIQARSLVACLYG
LATAPPRR
selected fasta
>putative NDP-hexose 2,3-dehydratase [SnogH]
ATGACGAAACTGTCCGCCCACCCGGCCGCCCCCGCGCACGGTGCCGTGCCGGACCCGCTG
CGGCTGGCTGCCTCGGCCCGCTCGGCGGGTGTGTGGCTGCCACGGACCACCGAGGTCCAC
CACTGGCTGGCCACGGTGGGGCAACACGCCCGGGCCCAGGTCGAGCGGGTCCCCCTGGCC
GAGCTCGACGGCTGGCTCCGCGACCCGGCGACCGGCAACATCGCCCACCGCAGCGGGGGC
TTCTTCACCGTGGAGGGGCTCGACGTGACCATCCCCCGGGCGCCCGTGCCGCACTGGGAG
CAGCCGATCATCAACCAGCCCGAGGTCGGGCTCCTCGGCATCGTCGTCAAGGAGTTCGAC
GGCGTCCTGCACTGCCTCATGCAGGCCAAGCTGGAACCCGGCAACTGCAACGGCATCCAG
CTGTCGCCTACCGTGCAGGCCACCCGCAGCAACTACACCCGGGTGCACCGCGGCCGGCCG
GTGCCGTATCTGGAGCACTTCCAGGACCCCGCCCGCCGGAGCCGGATCCTGGCCGACGTG
CGCCAGTCCGAGCAGGGCTCCTGGTTCCACCACAAACGCAACCGCAACATGGTCGTCGAG
GTCGAGGAGGACATCGACGTCCACGACGGCTTCTGCTGGCTGTCGCTGGGCCAGCTCCAC
GAGCTGCTGACCGTGGACAACCTGATCAACATGGACACCCGTACGGTGCTGTCCTGTCTG
CCCTTCGCCCACGCCGGCCTCGCGGCGGTGGCCGCCCCCGGCGCCGACCCGTTCCGCCGC
GCGCTGGTCGCCTCCTGCGCTCCCGACGGCTACAGCCGGCACTCGCTGGGCGACCTGCTG
AGCTGGATCACGGACGTGCGTACGCGCACCGAGGTGCGCACGGAGATGGTGCCGCTCGAC
GGCCTGCGGTCCTGGCGTCGCACGGACGAGCGGATCAGCCACGAGGACGGTGGCTTCTTC
GATGTGATCGGCGTGCGGGTGCGGACGCGGGGGCGCGAGGTCGCCGAGTGGACCCAGCCG
ATGATCGAACCGCACGCCAAGGGCGTCGTGGCCTTCCTCGTCCGGCCCATCGAGGGCGTG
CTGCACGTCCTGGTCCACGCGCGCGTGGAGCCCGGGTACGTCGACATCGTCGAGCTGGCG
CCGACCGTGCAGTGCACACCCGACAGCTACGAACGGCTGCCGGCGCGGGCCCGCCCGCTC
TTCCTCGACGAGGTTCTGCCGGCCCGGGCCGACCGAGTCCGCTTCGACGCCGAGCTCTCC
GAGGAGGGCGGCCGCTTCTACCACGCGCGCAACCGCTACCTGGTGGCGGAGACCGACCTG
GCCGCCGGCTTCGACCACCCCGACTTCCGCTGGGTGACGCTGGCCCAACTCGTGGAGCTG
CTGCGGCACAGTCACTACGTCAACATCCAGGCGCGCAGTCTCGTCGCCTGCCTGTACGGC
CTCGCCACGGCGCCGCCGAGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [36-240]  6.7999999999999e-87 PF03559 [274-478]  2.09999999999996e-83 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit