close all open/close all

CDS information : Nogl_00300


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction31,303 / 30,317 / - [in whole cluster]
2,601 / 1,615 / - [in contig]
Locationcomplement(30317..31303) [in whole cluster]
complement(1615..2601) [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)SnogG
Gene
Gene (GenBank)snogG
EC number
Keyword
  • nogalamine
Note
Note (GenBank)
Reference
ACC
PmId
[9349712] Characterization of Streptomyces nogalater genes encoding enzymes involved in glycosylation steps in nogalamycin biosynthesis. (Mol Gen Genet. , 1997)
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [SnogG]
MTAGIPRTVAVVGATGCVGRHVCDAFTRAGHDVVALARRAPAGPGRHPHRFLACDPAGLA
PRDLADLFQDARVDTVVNAAGGWLNTEDDNRYHHVRLVERLLAGTALMARTPRLVQIGSV
HEYGPVPAGDAVDESREPRPVTVYARTKHAGSQAVLRATRAGDADGVVLRAVNVCGPWVT
PASFLGTVTRRLSEAAPGEPVELTLSDARRDFVDGRDLADAVLRAATRPVTGEIFNIGRG
EALPIRSLVALLLDVAGLPPGTVKERLQEVASRGGDWTRVDTRRARRLLGWRPRIDLRTS
LHDMWREALTGLPPATGSHGDGYRESAL
selected fasta
>putative NDP-hexose C-4 ketoreductase [SnogG]
ATGACCGCCGGGATACCGCGGACGGTGGCCGTCGTCGGCGCCACCGGCTGCGTCGGCCGG
CACGTGTGCGACGCGTTCACGCGTGCCGGACACGACGTCGTGGCCCTCGCCCGCCGCGCG
CCGGCCGGGCCCGGCCGCCACCCGCACCGGTTCTTGGCGTGCGACCCCGCCGGGCTCGCC
CCGCGCGACCTCGCGGACCTCTTCCAGGACGCGCGCGTCGACACCGTCGTCAACGCCGCC
GGCGGCTGGCTGAACACGGAGGACGACAACCGCTACCACCATGTGCGGCTGGTCGAGCGG
CTGCTGGCGGGGACGGCCCTGATGGCGCGGACCCCGAGGCTGGTGCAGATCGGCTCCGTC
CACGAGTACGGGCCCGTCCCCGCCGGCGACGCCGTCGACGAGAGCCGCGAACCACGCCCG
GTGACGGTGTACGCCCGCACCAAGCACGCGGGCTCCCAGGCCGTACTGCGCGCCACGCGG
GCCGGGGACGCCGACGGGGTCGTGCTGCGGGCCGTGAACGTGTGCGGCCCGTGGGTCACC
CCGGCGAGCTTTCTCGGTACGGTGACGCGCCGGCTGAGCGAGGCCGCGCCGGGAGAGCCG
GTGGAACTCACCCTCAGCGACGCGCGACGGGACTTCGTGGACGGGCGCGACCTCGCCGAT
GCGGTCCTACGGGCCGCGACCCGCCCGGTCACCGGCGAGATCTTCAACATCGGACGCGGT
GAGGCCCTGCCGATCCGCTCCCTCGTCGCACTGCTGCTCGACGTGGCGGGGCTGCCCCCC
GGCACCGTGAAGGAGCGCCTCCAGGAGGTCGCCTCACGGGGCGGCGACTGGACGCGGGTC
GACACCCGGCGCGCGCGGCGGCTGCTGGGCTGGCGTCCTCGCATCGATCTGCGCACCTCT
CTGCACGACATGTGGCGCGAGGCCCTGACGGGCCTGCCGCCGGCGACCGGCTCGCACGGC
GACGGCTATCGGGAGTCAGCCTTATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [10-238]  1.09999999999999e-40 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [7-208]  5.59999999999999e-27 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-37]  0.176 Signal
Bacteria, Gram-positive   
 [1-19]  0.577 Signal
Eukaryota   
TMHMM No significant hit