close all open/close all

CDS information : Nogl_00320


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction32,924 / 31,953 / - [in whole cluster]
4,222 / 3,251 / - [in contig]
Locationcomplement(31953..32924) [in whole cluster]
complement(3251..4222) [in contig]
TypeCDS
Length972 bp (323 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)SnoaE
Gene
Gene (GenBank)snoaE
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
[9268006] Isolation and characterization of 8-demethoxy steffimycins and generation of 2,8-demethoxy steffimycins in Streptomyces steffisburgensis by the nogalamycin biosynthesis genes. (J Antibiot (Tokyo). , 1997)
Related Reference
ACC
Q54221
NITE
Griseu_00050
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[10467128] Heterologous expression, purification, reconstitution and kinetic analysis of an extended type II polyketide synthase. (Chem Biol. , 1999)
ACC
Q54811
NITE
Adria_00240
PmId
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>cyclase/dehydratase [SnoaE]
MTAGDTTLTTHRTEHRVTVSAPARRVFDLVADITGWPHTFPPTVHAEYAERGASEERIRI
WATANGEVKAWTSHRSLDREGLRVRFRQEKSQHPVAGMGGEWIIRPVDGERSEVILTHDF
QAVEDDPAHVDWIHRAVDRNSGAELAALKPRRNARTARNGTLFTFADEVTVTGAPGDVYD
YLNEARRWQERLPHVAAVSLDEPAPGVQRLGMDTKGPDGTVHTTESVRICFPQDRIVYKQ
FTMPPLMAVHTGTWRIAPAADGHGTTVTSLHTVVVDDSAVTTVLGPDATLADARRFLRDA
LGRNSRTTLGFAKEYAEERARRA
selected fasta
>cyclase/dehydratase [SnoaE]
ATGACAGCCGGCGACACCACCCTCACCACCCACCGCACCGAACACCGCGTCACCGTCTCG
GCACCCGCGCGGCGCGTCTTCGACCTGGTCGCGGACATCACAGGCTGGCCCCACACCTTC
CCCCCGACCGTGCACGCGGAGTACGCCGAGCGCGGGGCGAGTGAGGAACGCATCCGCATC
TGGGCCACGGCCAACGGCGAGGTCAAGGCCTGGACCTCGCACCGCTCGCTGGACCGGGAA
GGGCTGCGCGTCCGCTTCCGGCAGGAGAAGTCCCAGCACCCCGTGGCCGGCATGGGCGGC
GAGTGGATCATCCGGCCGGTGGACGGCGAGCGGAGCGAGGTGATCCTCACCCACGACTTC
CAGGCCGTGGAGGACGACCCGGCCCACGTGGACTGGATCCACCGTGCCGTGGACCGCAAC
AGCGGCGCCGAACTCGCGGCGCTGAAACCGCGGCGGAACGCGCGGACGGCGCGGAACGGC
ACCCTGTTCACCTTCGCCGACGAGGTCACCGTCACCGGTGCCCCCGGTGACGTCTACGAC
TACCTCAACGAGGCCCGGCGCTGGCAGGAGCGCCTCCCGCACGTCGCCGCGGTGAGCCTC
GACGAGCCCGCCCCCGGAGTGCAGCGGCTCGGCATGGACACCAAGGGACCCGACGGAACC
GTGCACACCACCGAGTCGGTCCGCATCTGCTTCCCCCAGGACCGCATCGTCTACAAGCAG
TTCACGATGCCACCGCTGATGGCCGTCCATACCGGCACATGGCGGATCGCACCCGCCGCG
GACGGCCACGGCACGACCGTCACCTCCCTCCACACCGTCGTGGTCGACGACAGCGCCGTC
ACCACCGTCCTGGGCCCGGACGCCACCCTCGCCGACGCCCGCCGCTTCCTGCGTGACGCC
CTCGGCCGCAACAGCCGTACCACCCTCGGCTTCGCCAAGGAATACGCCGAGGAGCGCGCG
CGGCGGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [11-149]  7.90000000000001e-11 PF10604 [164-303]  1.2e-07 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [12-122]  2.5e-13 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-23]  0.229 Signal
Bacteria, Gram-positive   
 [1-46]  0.079 Signal
Bacteria, Gram-negative   
TMHMM No significant hit