close all open/close all

CDS information : Nogl_00330


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction33,773 / 32,985 / - [in whole cluster]
5,071 / 4,283 / - [in contig]
Locationcomplement(32985..33773) [in whole cluster]
complement(4283..5071) [in contig]
TypeCDS
Length789 bp (262 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)SnoaD
Gene
Gene (GenBank)snoaD
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
[9268006] Isolation and characterization of 8-demethoxy steffimycins and generation of 2,8-demethoxy steffimycins in Streptomyces steffisburgensis by the nogalamycin biosynthesis genes. (J Antibiot (Tokyo). , 1997)
Related Reference
ACC
Q56166
NITE
Jado_00110
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)
ACC
Q54812
NITE
Adria_00250
PmId
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [SnoaD]
MPDTDGRVAVVTGGTSGIGLAVVKALAATGYACRSLCARSQDAVDSTVEELRDEKLEVDG
RSCDVRSTDDVREFIGFATRRFGGVDVLVNNAGRNGGGPTARITDELWLDVIETNLTSVF
RVTREVLTTGGMLAAGRGRIINIASTGGKQGVVLGAPYSASKHGVVGFTKALGLELAKSG
ITVNAVCPGYVETPMGERVGRGYAEVWDTSEEAVLERFQAKIPLGRYAQPEEVAGLVTYL
TTPTADSITAQALNVCGGLGNY
selected fasta
>putative polyketide C-9 ketoreductase [SnoaD]
ATGCCGGACACGGACGGGCGGGTCGCCGTCGTCACAGGCGGCACCAGCGGGATAGGACTC
GCGGTGGTGAAGGCACTGGCTGCGACAGGATATGCGTGTCGTTCCCTGTGTGCCCGGAGC
CAGGACGCCGTCGACAGCACCGTGGAGGAGCTGCGCGACGAGAAGCTGGAGGTGGACGGG
CGCTCCTGCGACGTGCGTTCCACGGACGACGTACGGGAGTTCATCGGCTTCGCCACGCGG
CGCTTCGGCGGCGTGGACGTGCTGGTCAACAACGCCGGCCGCAACGGCGGAGGCCCGACC
GCGCGGATAACCGACGAGCTGTGGCTCGACGTCATCGAGACCAACCTCACCAGCGTCTTC
CGCGTCACCCGCGAGGTGCTGACCACCGGAGGGATGCTCGCCGCCGGACGCGGCAGGATC
ATCAACATCGCCTCCACCGGCGGCAAACAGGGTGTCGTCCTCGGTGCCCCGTACTCGGCC
TCCAAGCACGGCGTCGTCGGCTTCACCAAGGCACTGGGCCTGGAGCTGGCCAAGAGCGGC
ATCACCGTCAACGCCGTCTGCCCGGGCTATGTCGAGACTCCCATGGGCGAGCGGGTCGGT
CGCGGCTACGCCGAGGTCTGGGACACCTCCGAGGAGGCGGTGCTGGAGCGCTTCCAGGCG
AAGATCCCGCTCGGCCGCTACGCGCAGCCCGAGGAGGTCGCCGGCCTCGTCACCTACCTG
ACCACGCCCACCGCCGACTCCATCACCGCGCAGGCGCTCAACGTCTGCGGCGGCCTGGGA
AACTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [8-176]  3.7e-33 PF00106
PF00106   adh_short
 [1-262]  9.59999914716171e-16 PIRSF000126
PIRSF000126   11-beta-HSD1
 [83-94]  1.29999924468179e-14 PR00080 [138-146]  1.29999924468179e-14 PR00080 [158-177]  1.29999924468179e-14 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [8-25]  5.59999989417026e-49 PR00081 [83-94]  5.59999989417026e-49 PR00081 [132-148]  5.59999989417026e-49 PR00081 [158-177]  5.59999989417026e-49 PR00081 [179-196]  5.59999989417026e-49 PR00081 [223-243]  5.59999989417026e-49 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-259]  4.2e-78 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [145-173]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-27]  0.917 Signal
Bacteria, Gram-positive   
TMHMM No significant hit