close all open/close all

CDS information : Nogl_00340


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction34,023 / 34,883 / + [in whole cluster]
5,321 / 6,181 / + [in contig]
Location34023..34883 [in whole cluster]
5321..6181 [in contig]
TypeCDS
Length861 bp (286 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative nogalonic acid O-methyltransferase
Product (GenBank)SnoaC
Gene
Gene (GenBank)snoaC
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
Related Reference
ACC
Q54818
NITE
Adria_00310
PmId
[7601857] Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>putative nogalonic acid O-methyltransferase [SnoaC]
MDTAEYKQTVTAAFDRAAAHYDRLGVEFFTPMGLRLVDHADPRPGQRVLDVGCGRGACLF
PAARRVAPDGYALGIDIAPAMVEEAAAEAERLGMPHVEVRVMDGERPALPERSFERVLGS
YSVIFFPEALPALVRYAGLLADGGRIAFTSPVFTEDTFPFLPPVFTELIPRSLLDTLPPD
WRPEALRRRFNSWLERPDDLEATMRRAGFGEVGITDETVPMVAVSGEAWVDWSHTNGMRL
LWQHLPRDEAQRLRERLITELDAMRRADAPLSIPVPVRFVTAVVDR
selected fasta
>putative nogalonic acid O-methyltransferase [SnoaC]
ATGGACACGGCGGAATACAAGCAGACCGTAACCGCGGCCTTCGACCGCGCGGCGGCGCAC
TACGACCGGCTGGGGGTCGAGTTCTTCACCCCCATGGGACTCCGGCTGGTGGATCACGCG
GATCCCCGGCCGGGCCAGCGGGTGCTCGACGTCGGCTGCGGGCGCGGCGCCTGTCTGTTC
CCCGCGGCCCGGCGCGTCGCTCCGGACGGCTATGCCCTCGGCATCGACATCGCGCCGGCG
ATGGTCGAGGAGGCGGCCGCGGAGGCCGAACGGCTGGGCATGCCGCATGTCGAGGTGCGT
GTCATGGACGGGGAGCGCCCCGCTCTGCCGGAACGCTCCTTCGAGCGGGTGCTGGGCAGC
TACAGCGTGATCTTCTTCCCGGAGGCGCTGCCCGCTCTCGTCCGCTATGCCGGGCTGTTG
GCGGACGGGGGGCGCATCGCGTTCACCAGCCCGGTGTTCACCGAGGACACCTTTCCCTTC
CTGCCCCCCGTGTTCACGGAGCTGATCCCGCGCTCCCTGCTGGACACCCTCCCGCCCGAC
TGGCGGCCGGAGGCACTGCGCCGACGGTTCAACAGCTGGCTGGAGCGGCCCGACGATCTG
GAAGCGACGATGCGCCGGGCGGGATTCGGCGAGGTGGGCATCACCGACGAGACGGTCCCG
ATGGTGGCCGTCTCCGGGGAGGCCTGGGTGGACTGGTCCCACACCAACGGCATGCGGCTG
TTGTGGCAGCACCTGCCGCGGGACGAGGCGCAGCGGCTACGGGAGCGGCTGATCACGGAG
CTGGACGCGATGCGTCGGGCCGACGCACCGCTGTCCATCCCGGTACCGGTGCGCTTCGTC
ACGGCGGTGGTGGACCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit