close all open/close all

CDS information : Nogl_00350


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction35,279 / 34,923 / - [in whole cluster]
6,577 / 6,221 / - [in contig]
Locationcomplement(34923..35279) [in whole cluster]
complement(6221..6577) [in contig]
TypeCDS
Length357 bp (118 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Product12-deoxynogalonic acid C-12 oxygenase
Product (GenBank)SnoaB
GenesnoaB
Gene (GenBank)=snoaB
EC number
Keyword
  • anthraquinone
Note
Note (GenBank)
Reference
ACC
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
[19255477] Expression, purification and crystallization of the cofactor-independent monooxygenase SnoaB from the nogalamycin biosynthetic pathway. (Acta Crystallogr Sect F Struct Biol Cryst Commun. , 2009)
[20052967] Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism. (Biochemistry. , 2010)
[27307041] Monooxygenase Substrates Mimic Flavin to Catalyze Cofactorless Oxygenations. (J Biol Chem. , 2016)
Related Reference
ACC
Q8VWB4
PmId
[12399480] Expression, purification, and characterization of AknX anthrone oxygenase, which is involved in aklavinone biosynthesis in Streptomyces galilaeus. (J Bacteriol. , 2002)

close this sectionSequence

selected fasta
>12-deoxynogalonic acid C-12 oxygenase [SnoaB]
MPTRVNDGVDADEVTFVNRFTVHGGPAEFESVFARTAAFFARQPGFVRHTLLRERDKDNS
YVNIAVWTDHDAFRRALAQPGFLPHATALRALSTSEHGLFTARQTLPEGGDTTGSGHR
selected fasta
>12-deoxynogalonic acid C-12 oxygenase [SnoaB]
ATGCCGACACGAGTGAACGATGGCGTCGACGCGGACGAGGTCACCTTCGTCAACAGGTTC
ACCGTCCACGGGGGGCCCGCGGAGTTCGAGAGCGTCTTCGCACGGACCGCGGCCTTCTTC
GCGCGGCAGCCCGGGTTCGTCCGGCATACGCTGCTGCGCGAGCGGGACAAGGACAACAGC
TATGTGAACATCGCCGTCTGGACCGACCACGACGCCTTCCGGCGGGCCCTGGCCCAGCCC
GGGTTCCTGCCGCACGCCACCGCGTTGCGGGCCCTGAGCACCAGCGAACACGGGCTGTTC
ACGGCGCGCCAGACACTGCCGGAAGGCGGCGATACGACCGGCTCCGGACATCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [14-86]  8.59999999999999e-19 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [4-109]  1.70000295590054e-18 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP
 [1-41]  0.044 Signal
Bacteria, Gram-negative   
TMHMM No significant hit