close all open/close all

CDS information : Nogl_00360


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction37,383 / 35,386 / - [in whole cluster]
8,681 / 6,684 / - [in contig]
Locationcomplement(35386..37383) [in whole cluster]
complement(6684..8681) [in contig]
TypeCDS
Length1,998 bp (665 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional regulator
Product (GenBank)Snora
Gene
Gene (GenBank)snorA
EC number
Keyword
  • SARP family
Note
Note (GenBank)
Reference
ACC
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
[9349712] Characterization of Streptomyces nogalater genes encoding enzymes involved in glycosylation steps in nogalamycin biosynthesis. (Mol Gen Genet. , 1997)
Related Reference
ACC
Q2MGB3
NITE
Fred_00260
PmId
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)
ACC
P25941
PmId
[2253887] Primary structure of AfsR, a global regulatory protein for secondary metabolite formation in Streptomyces coelicolor A3(2). (Gene. , 1990)
[11952895] afsS is a target of AfsR, a transcriptional factor with ATPase activity that globally controls secondary metabolism in Streptomyces coelicolor A3(2). (Mol Microbiol. , 2002)
[17434533] AfsR recruits RNA polymerase to the afsS promoter: a model for transcriptional activation by SARPs. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>transcriptional regulator [Snora]
MCRPRDHRASVQVVTPGASSKEKREEDLEFRLLGPVEILWQGRNIMPTAPKPRQVISLLM
LRHNTVVQAAELIDELWPELPPPSAITTLQTYIYKFRKILMKQGADDLLRTQPGGYILTI
PPSTVDVNRFERDADDGQELLQRGDAAGGTKLGHALALWRGPALADVVASGRLFSYVTRL
EELRFRILELRIEADLATGRHRELVSELKSLVLAHPLHEHLHGLLMLALHRSGRPHEALE
VYRSVRHKMIEDLALEPAQDFATLHHTLLSDSPPEAPEPLWPAQHLTTKQPERVTIAREP
APDTAPSPLARPAQLPADIVDFVGRRAVLDRLVGVLAQPGGSRDAGRTAVRVGVVTGAPG
VGKSVLAVHAAHTLRPRYPDGQLYADLRGSSSEPRDQSEVLAGFLRALDIPPARIPDRLE
ERGALFRSCTAGRRVLVLLDDVACSPQVRHLLPGDPHCALLATGRRRMPGLVEASHVELG
LPGRTEGREMLARVLGRQRVEREPAAADTIVTLLGHHPLALRCVAGRSRRCRGCPWRPWP
RQLDTAPRILDAARLGELDVRSRFDLSYEGLSPVEQGVFRLLSMLESSPFTVAQAAGLLG
WRSADIQPVLEALADNHLLSAGPGGGTAPPATPTHGSPWRTPGERLEATLSQPRAVEGAG
AASAV
selected fasta
>transcriptional regulator [Snora]
GTGTGCCGTCCGCGTGACCACCGGGCGTCGGTGCAGGTGGTCACGCCTGGCGCAAGTTCG
AAGGAAAAACGGGAGGAAGACTTGGAATTTCGACTGCTGGGTCCGGTTGAAATACTCTGG
CAGGGGCGCAACATCATGCCGACGGCTCCCAAGCCGCGGCAGGTCATATCCCTTCTGATG
CTCCGTCACAACACAGTCGTGCAGGCTGCGGAGCTGATCGACGAATTATGGCCGGAGCTG
CCGCCGCCGAGCGCGATCACCACCCTCCAGACCTACATCTACAAATTCCGGAAGATTCTC
ATGAAGCAGGGGGCCGATGATCTTCTGCGTACCCAGCCGGGCGGATACATCCTGACGATC
CCGCCCTCCACCGTCGACGTCAACCGGTTCGAACGGGACGCCGACGACGGGCAGGAACTG
CTGCAGCGCGGTGACGCCGCCGGCGGGACGAAGCTCGGCCACGCCCTGGCCCTGTGGCGG
GGCCCAGCACTGGCCGATGTCGTCGCCAGCGGACGCCTGTTCTCGTACGTCACGCGGCTG
GAGGAGCTGCGGTTTCGCATCCTCGAACTGCGCATCGAGGCGGACCTCGCGACCGGGCGG
CACCGGGAACTCGTGAGCGAGCTGAAATCGCTGGTACTGGCACACCCCCTCCACGAGCAC
CTGCACGGGCTGCTGATGCTGGCCCTGCACCGGTCGGGGCGGCCCCACGAGGCGTTGGAG
GTCTACCGGAGCGTACGCCACAAGATGATCGAGGACCTCGCCCTGGAACCCGCCCAGGAC
TTCGCCACTTTGCACCACACCCTGCTGTCCGACTCCCCGCCCGAGGCACCCGAACCCCTC
TGGCCGGCACAGCACCTGACGACCAAGCAGCCGGAACGCGTCACCATCGCCCGCGAACCA
GCCCCGGACACCGCCCCCAGCCCGCTGGCCAGACCGGCCCAATTGCCCGCCGACATCGTG
GACTTCGTCGGCCGACGGGCGGTGCTGGACCGGCTCGTCGGTGTGCTGGCACAACCCGGC
GGCAGCCGCGATGCCGGGCGCACGGCGGTCCGGGTCGGCGTGGTGACCGGTGCGCCGGGC
GTGGGCAAGAGCGTGCTGGCCGTGCACGCGGCGCACACGCTGCGCCCGCGCTATCCCGAC
GGGCAGCTCTACGCCGACCTGCGCGGCTCCTCGTCCGAACCCCGCGACCAGTCCGAGGTG
CTGGCGGGCTTCCTGCGGGCCCTCGACATCCCGCCCGCCCGGATCCCGGACCGGTTGGAG
GAACGCGGCGCGCTGTTCCGTTCCTGCACGGCCGGACGCAGGGTGCTTGTCCTGCTCGAC
GACGTGGCCTGTTCGCCACAGGTGCGGCATCTGCTGCCCGGCGACCCGCACTGCGCGCTG
CTGGCCACCGGCCGGCGCCGTATGCCCGGGCTGGTGGAGGCCTCGCACGTCGAACTCGGC
CTGCCCGGCAGAACCGAGGGCCGGGAGATGCTGGCCCGTGTGCTGGGCAGGCAGCGGGTG
GAGCGGGAACCCGCGGCGGCCGACACCATCGTCACGCTCCTCGGCCACCACCCACTGGCG
CTGCGCTGCGTCGCGGGACGCTCACGGCGATGCCGGGGCTGTCCCTGGAGGCCATGGCCG
AGGCAGCTCGACACCGCGCCCCGCATCCTGGACGCGGCCCGGCTGGGCGAACTCGACGTA
CGGTCCCGGTTCGATCTGAGCTACGAGGGCCTCAGCCCGGTGGAGCAGGGGGTGTTCCGG
CTGCTGAGCATGTTGGAGAGCTCCCCGTTCACCGTCGCGCAGGCCGCGGGGCTGTTGGGG
TGGAGAAGCGCCGACATACAGCCCGTACTGGAGGCACTGGCCGACAACCACCTGCTCAGC
GCAGGACCGGGCGGGGGGACGGCGCCGCCCGCTACTCCTACCCACGGCTCACCCTGGCGT
ACGCCGGGGGAGCGCTTGGAGGCGACGCTGTCCCAGCCCCGCGCCGTCGAGGGTGCCGGC
GCCGCCAGCGCCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [42-118]  1.69999922284049e-09 SM00862
SM00862   Trans_reg_C
 [46-118]  8.1e-14 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [125-269]  3.99998544139406e-43 SM01043
SM01043   BTAD
 [125-269]  3.80000000000003e-45 PF03704
PF03704   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [48-121]  3.3e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [27-119]  5.59999989417023e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit