close all open/close all

CDS information : Nogl_00370


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction38,140 / 39,432 / + [in whole cluster]
9,438 / 10,730 / + [in contig]
Location38140..39432 [in whole cluster]
9438..10730 [in contig]
TypeCDS
Length1,293 bp (430 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)Snoa1
Gene
Gene (GenBank)snoa1
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)

close this sectionPKS/NRPS Module

KS7..380

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [Snoa1]
MKESINRRVVITGIGIVAPDATGVKPFWDLLTAGRTATRTITAFDPSPFRSRIAAECDFD
PLAEGLTPQQIRRMDRATQFAVVSARESLEDSGLDLGALDASRTGVVVGSAVGCTTSLEE
EYAVVSDSGRNWLVDDGYAVPHLFDYFVPSSIAAEVAHDRIGAEGPVSLVSTGCTSGLDA
VGRAADLIAEGAADVMLAGATEAPISPITVACFDAIKATTPRNDTPAEASRPFDRTRNGF
VLGEGAAVFVLEEFEHARRRGALVYAEIAGFATRCNAFHMTGLRPDGREMAEAIGVALAQ
AGKAPADVDYVNAHGSGTRQNDRHETAAFKRSLGDHAYRVPVSSIKSMIGHSLGAIGSLE
IAASVLAITHDVVPPTANLHEPDPECDLDYVPLRARACPVDTVLTVGSGFGGFQSAMVLC
GPGSRGRSAA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [Snoa1]
ATGAAGGAATCCATCAACCGTCGCGTGGTCATCACCGGAATAGGGATCGTCGCGCCCGAT
GCCACCGGGGTGAAACCGTTCTGGGATCTGCTGACGGCCGGTCGCACCGCGACCCGGACC
ATCACCGCCTTCGATCCCTCTCCGTTCCGTTCCCGCATCGCCGCGGAATGCGATTTCGAC
CCGCTTGCCGAAGGGCTGACCCCCCAGCAGATCCGGCGTATGGACCGGGCCACGCAGTTC
GCGGTCGTCAGCGCCCGGGAAAGCCTGGAGGACAGCGGACTCGACCTCGGCGCCCTGGAC
GCCTCCCGCACCGGCGTGGTCGTCGGCAGCGCGGTCGGCTGCACCACGAGCCTGGAAGAG
GAGTACGCGGTCGTCAGCGACAGCGGCCGGAACTGGCTGGTCGACGACGGCTACGCCGTA
CCGCACCTATTCGACTACTTCGTGCCCAGCTCCATCGCCGCCGAGGTGGCACACGACCGC
ATCGGCGCGGAGGGCCCCGTCAGCCTCGTGTCGACCGGGTGCACCTCGGGCCTGGACGCC
GTGGGCCGCGCGGCCGACCTGATCGCCGAGGGAGCGGCGGATGTGATGCTGGCCGGTGCG
ACCGAGGCGCCCATCTCCCCCATCACCGTGGCGTGCTTCGATGCCATCAAGGCGACCACC
CCCCGCAACGACACGCCCGCCGAGGCGTCCCGTCCGTTCGACCGCACCAGGAACGGGTTC
GTACTCGGCGAGGGCGCTGCCGTGTTCGTCCTGGAGGAGTTCGAACACGCGCGCCGCCGG
GGCGCGCTCGTGTACGCGGAGATCGCCGGGTTCGCCACTCGCTGCAACGCCTTCCACATG
ACCGGTCTGCGCCCGGACGGGCGGGAGATGGCGGAGGCCATCGGGGTGGCGCTCGCCCAG
GCGGGCAAGGCGCCGGCTGACGTCGACTACGTCAACGCCCACGGTTCCGGCACCCGGCAG
AATGACCGTCACGAGACGGCGGCCTTCAAGCGCAGTCTCGGCGACCACGCCTACCGGGTC
CCGGTCAGCAGCATCAAATCCATGATCGGGCACTCGCTGGGCGCGATCGGCTCCCTGGAG
ATCGCCGCCTCCGTGCTGGCCATCACACACGACGTGGTGCCGCCCACCGCCAATCTGCAC
GAGCCGGATCCCGAGTGCGATCTGGACTACGTGCCGCTGCGGGCGCGTGCGTGCCCGGTG
GACACGGTGCTCACGGTGGGCAGCGGGTTCGGCGGTTTCCAGAGCGCCATGGTGCTGTGC
GGTCCGGGCTCGCGGGGAAGGTCGGCCGCGTGA
KS7..380
KS19..1140

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [7-255]  3.40000000000004e-60 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [265-380]  4.70000000000003e-39 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [4-270]  2.79999999999994e-65 G3DSA:3.40.47.10 [275-419]  2.80000000000001e-52 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [6-262]  1.79999754022378e-68 SSF53901 [224-422]  2.99998750445706e-65 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [165-181]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-23]  0.165 Signal
Eukaryota   
TMHMM No significant hit