close all open/close all

CDS information : Nogl_00380


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction39,429 / 40,658 / + [in whole cluster]
10,727 / 11,956 / + [in contig]
Location39429..40658 [in whole cluster]
10727..11956 [in contig]
TypeCDS
Length1,230 bp (409 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)Snoa2
Gene
Gene (GenBank)snoa2
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)

close this sectionPKS/NRPS Module

CLF4..362

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [Snoa2]
MTAAVVVTGLGVVAPTGLGVREHWSSTVRGASAIGPVTRFDAGRYPSKLAGEVPGFVPED
HLPSRLMPQTDHMTRLALVAADWAFQDAAVDPSKLPEYGVGVVTASSAGGFEFGHRELQN
LWSLGPQYVSAYQSFAWFYAVNTGQVSIRHGLRGPGGVLVTEQAGGLDALGQARRQLRRG
LPMVVAGAVDGSPCPWGWVAQLSSGGLSTSDDPRRAYLPFDAAAGGHVPGEGGALLVLES
DESARARGVTRWYGRIDGYAATFDPPPGSGRPPNLLRAAQAALDDAEVGPEAVDVVFADA
SGTPDEDAAEADAVRRLFGPYGVPVTAPKTMTGRLSAGGAALDVATALLALREGVVPPTV
NVSRPRPEYELDLVLAPRRTPLARALVLARGRGGFNAAMVVAGPRAETR
selected fasta
>polyketide synthase chain length factor subunit [Snoa2]
GTGACGGCCGCCGTGGTGGTGACCGGTCTCGGCGTCGTCGCCCCCACCGGTCTCGGGGTG
CGGGAGCACTGGTCGAGTACGGTCCGGGGGGCGTCGGCGATCGGACCGGTCACCCGGTTC
GACGCCGGCCGGTACCCCAGCAAACTGGCCGGAGAGGTGCCCGGTTTCGTCCCGGAGGAC
CATCTGCCCAGCCGGCTGATGCCGCAGACGGACCATATGACGCGCCTGGCGCTCGTCGCG
GCGGACTGGGCCTTCCAGGACGCCGCCGTGGACCCGTCGAAGCTGCCGGAGTACGGCGTC
GGCGTGGTCACCGCGAGTTCGGCGGGGGGGTTCGAATTCGGCCACCGCGAGCTGCAGAAC
CTGTGGAGCCTGGGCCCGCAGTACGTCAGCGCGTATCAGTCGTTCGCATGGTTCTATGCC
GTGAACACCGGTCAGGTGTCCATCCGGCACGGGCTGCGCGGCCCGGGCGGGGTGCTGGTG
ACGGAACAGGCGGGCGGCCTGGACGCCCTTGGGCAGGCCCGGCGGCAGTTGCGGCGCGGA
CTGCCGATGGTGGTCGCGGGAGCCGTTGACGGCTCGCCCTGCCCCTGGGGCTGGGTGGCG
CAGCTCAGCTCGGGCGGCCTCAGCACGTCGGACGACCCGCGCCGGGCCTATCTGCCGTTC
GACGCCGCAGCCGGCGGACACGTGCCGGGAGAGGGCGGCGCCCTGCTCGTCCTGGAGAGC
GACGAGTCGGCCCGGGCGCGCGGGGTGACGCGGTGGTACGGGCGCATCGATGGGTACGCC
GCCACATTCGACCCCCCGCCCGGTTCGGGGCGCCCGCCGAACCTGCTGCGGGCCGCGCAG
GCGGCACTGGACGACGCGGAGGTCGGACCCGAGGCGGTCGACGTGGTGTTCGCGGACGCG
TCCGGCACCCCGGACGAGGACGCGGCGGAGGCCGACGCGGTGCGGCGCCTGTTCGGACCG
TACGGCGTTCCGGTGACGGCGCCGAAGACCATGACCGGCCGCCTCAGCGCGGGCGGCGCG
GCCCTCGACGTGGCGACGGCGCTGCTGGCGCTGCGCGAGGGCGTCGTCCCGCCGACGGTC
AACGTCTCCCGGCCGCGGCCGGAGTACGAGCTGGACCTGGTGCTCGCCCCCCGGCGCACG
CCCCTGGCCAGGGCCCTGGTGCTCGCGCGGGGCCGGGGCGGGTTCAATGCGGCGATGGTC
GTGGCGGGGCCGCGCGCGGAGACACGGTGA
CLF4..362
CLF10..1086

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [4-242]  7.29999999999998e-53 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [253-362]  2.2e-26 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-256]  3.89999999999997e-54 G3DSA:3.40.47.10 [271-402]  1.29999999999998e-37 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-249]  5.00000909915354e-60 SSF53901 [212-404]  1.10000150671643e-46 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-19]  0.973 Signal
Eukaryota   
TMHMM No significant hit