close all open/close all

CDS information : Nogl_00400


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction41,002 / 41,739 / + [in whole cluster]
12,300 / 13,037 / + [in contig]
Location41002..41739 [in whole cluster]
12300..13037 [in contig]
TypeCDS
Length738 bp (245 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose N-methyltransferase
Product (GenBank)SnogX
Gene
Gene (GenBank)snogX
EC number2.1.1.-
Keyword
  • nogalamine
Note
Note (GenBank)
Reference
ACC
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
Q9ZGH6
NITE
Pikro_00100
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[12119032] Expression, purification, and characterization of two N,N-dimethyltransferases, tylM1 and desVI, involved in the biosynthesis of mycaminose and desosamine. (Biochemistry. , 2002)

close this sectionSequence

selected fasta
>putative NDP-hexose N-methyltransferase [SnogX]
MTRVYGTELTQIYELVHEGRGKDYGAEAEEITRRIRARLPGARTLLDVACGTGAHLRAFA
TRFEEVEGVELSEAMCAVARRRLPGVALHRADMRDFRLGRTFHAVTCMFGSIGYARTPQE
LTATLRCFAAHLAPGGVAAVDPWWFPETYLDGYVSGDTMTVDGRTVSRVSHSTREGTASV
MRVHYLVADAALGVRHFSESHRISLFSREQYEEAFSRAGFAVEYVPRLHAGRGLFLGVRK
SGRAG
selected fasta
>putative NDP-hexose N-methyltransferase [SnogX]
GTGACGCGTGTGTACGGCACGGAACTCACACAGATCTACGAACTGGTCCACGAGGGCCGC
GGCAAGGATTACGGAGCGGAGGCCGAGGAGATCACCCGCCGGATCCGGGCGCGGTTGCCC
GGGGCGCGGACGCTGCTCGATGTCGCCTGCGGCACGGGCGCGCACCTGCGGGCGTTCGCG
ACGCGATTCGAGGAGGTGGAGGGGGTGGAACTGTCCGAGGCGATGTGCGCGGTCGCGCGC
CGCCGCCTGCCCGGAGTGGCCCTGCACCGGGCGGACATGCGCGACTTCCGGCTCGGCCGG
ACGTTCCACGCCGTCACCTGCATGTTCGGCTCGATCGGCTACGCCCGTACGCCGCAGGAG
CTCACGGCGACGCTGCGCTGCTTCGCCGCGCACCTGGCGCCCGGCGGGGTGGCCGCGGTC
GACCCGTGGTGGTTCCCGGAGACGTACCTGGACGGGTATGTCTCGGGCGACACCATGACC
GTGGACGGGCGGACGGTCTCCCGCGTCTCCCACTCGACGCGCGAGGGCACCGCCTCGGTG
ATGCGGGTGCACTACCTGGTGGCGGACGCCGCCTTGGGCGTGCGCCACTTCTCGGAGTCG
CACCGCATCTCGCTGTTCTCCCGCGAGCAGTACGAGGAGGCCTTCTCGCGGGCGGGGTTC
GCGGTGGAGTACGTCCCGCGGCTGCACGCGGGGCGCGGACTGTTCCTCGGTGTCCGGAAG
TCCGGGCGGGCGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-6]  0.048 Signal
Eukaryota   
 [1-42]  0.036 Signal
Bacteria, Gram-positive   
TMHMM No significant hit