close all open/close all

CDS information : Nogl_00410


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction42,819 / 41,785 / - [in whole cluster]
14,117 / 13,083 / - [in contig]
Locationcomplement(41785..42819) [in whole cluster]
complement(13083..14117) [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productdemethoxynogalose C-2' O-methyltransferase
Product (GenBank)SnogY
Gene
Gene (GenBank)snogY
EC number2.1.1.-
Keyword
  • nogalose
Note
Note (GenBank)
Reference
ACC
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[22120896] Identification of late-stage glycosylation steps in the biosynthetic pathway of the anthracycline nogalamycin. (Chembiochem. , 2012)
Related Reference
ACC
Q83WF2
PmId
[19415708] Functional analysis of MycE and MycF, two O-methyltransferases involved in the biosynthesis of mycinamicin macrolide antibiotics. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>demethoxynogalose C-2' O-methyltransferase [SnogY]
MAGVLLAEVAFRCPPPVNTLPVHVGLDLEHDGAVRRSALRLVRDEPVTVHPRPQEGTPTL
LRFSLADLVRRLFGPEEAGQGGDFHNEFLPQPPGAENMMETWSAVSHATHTVMTALSTLT
PDLGELAVRYGSDKWASFHWYTPHYDHHFRPLRNTPVRVLEIGVGGYEEYDGGGSLKMWK
RYFRRGLIHGLDIVDKTRLSEPRLTVLTGDQNDPETLERIVREHGPFDVVIDDGSHVNQH
VHTSFRTLFPHLRSGGLYVIEDLQTSYWPEFGGTDGPNAAPDTSLGLVKQLLDDLHHQER
PKDRDTADATRSTVTGVHVYHNIAFVTKGVNGEAPLPDWMLQGH
selected fasta
>demethoxynogalose C-2' O-methyltransferase [SnogY]
GTGGCCGGCGTCCTCCTCGCGGAGGTCGCGTTCCGCTGCCCGCCGCCGGTCAACACGCTC
CCCGTCCACGTGGGCCTCGATCTCGAACACGACGGTGCGGTGCGGCGCTCGGCCCTGCGG
CTGGTCCGGGACGAACCGGTGACCGTCCACCCACGCCCGCAGGAGGGCACCCCCACACTG
CTGCGCTTCAGCCTCGCAGACTTGGTACGGCGGTTGTTCGGTCCCGAGGAAGCCGGCCAG
GGCGGGGACTTCCACAACGAGTTCCTGCCGCAGCCACCCGGTGCCGAGAACATGATGGAG
ACCTGGAGCGCCGTCTCCCACGCGACCCACACGGTGATGACCGCGCTCTCCACCCTCACC
CCCGATCTCGGTGAACTCGCCGTCCGGTACGGCTCCGACAAGTGGGCCAGCTTCCACTGG
TACACCCCGCACTACGACCACCATTTCCGCCCACTGCGGAACACGCCCGTCCGTGTGCTG
GAGATCGGCGTCGGCGGCTACGAGGAGTACGACGGCGGCGGCTCGCTGAAGATGTGGAAG
CGCTACTTCCGGCGCGGCCTGATTCACGGTCTCGACATCGTCGACAAGACGCGGCTGAGC
GAGCCCCGGCTGACCGTGCTCACCGGCGACCAGAACGACCCGGAGACGCTGGAGCGGATC
GTCCGCGAGCACGGACCGTTCGACGTCGTCATCGACGACGGAAGCCACGTCAACCAGCAC
GTCCACACGTCGTTCCGCACCCTCTTCCCGCACCTGCGGTCCGGCGGGCTGTACGTGATC
GAGGACCTGCAAACCTCGTACTGGCCCGAGTTCGGGGGCACCGACGGCCCCAACGCCGCC
CCGGACACCTCCCTGGGCCTGGTCAAACAACTGCTGGACGACCTGCACCACCAGGAGCGC
CCCAAGGACCGCGACACGGCGGACGCGACGCGGAGCACGGTCACCGGCGTGCACGTGTAC
CACAACATCGCCTTCGTCACGAAGGGCGTCAACGGCGAGGCCCCGCTGCCCGACTGGATG
CTCCAGGGGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-19]  0.84 Signal
Eukaryota   
TMHMM No significant hit