close all open/close all

CDS information : Nogl_00420


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction43,276 / 44,511 / + [in whole cluster]
14,574 / 15,809 / + [in contig]
Location43276..44511 [in whole cluster]
14574..15809 [in contig]
TypeCDS
Length1,236 bp (411 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)SnogZ
Gene
Gene (GenBank)snogZ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8668120] A gene cluster involved in nogalamycin biosynthesis from Streptomyces nogalater: sequence analysis and complementation of early-block mutations in the anthracycline pathway. (Mol Gen Genet. , 1996)
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[22120896] Identification of late-stage glycosylation steps in the biosynthetic pathway of the anthracycline nogalamycin. (Chembiochem. , 2012)
Related Reference
ACC
Q194P9
NITE
Mith_00260
PmId
[10660060] Characterization of two glycosyltransferases involved in early glycosylation steps during biosynthesis of the antitumor polyketide mithramycin by Streptomyces argillaceus. (Mol Gen Genet. , 2000)
ACC
Q70J70
NITE
Chro_00280
PmId
[16391039] Deoxysugar transfer during chromomycin A3 biosynthesis in Streptomyces griseus subsp. griseus: new derivatives with antitumor activity. (Appl Environ Microbiol. , 2006)
ACC
Q9ZGH7
NITE
Pikro_00090
PmId
[15161264] Characterization of the glycosyltransferase activity of desVII: analysis of and implications for the biosynthesis of macrolide antibiotics. (J Am Chem Soc. , 2004)
[15358425] New olivosyl derivatives of methymycin/pikromycin from an engineered strain of Streptomyces venezuelae. (FEMS Microbiol Lett. , 2004)
[20695498] Characterization of glycosyltransferase DesVII and its auxiliary partner protein DesVIII in the methymycin/picromycin biosynthetic pathway. (Biochemistry. , 2010)
[23770075] Combinatorial biosynthesis and antibacterial evaluation of glycosylated derivatives of 12-membered macrolide antibiotic YC-17. (J Biotechnol. , 2013)
[26552796] In vivo investigation to the macrolide-glycosylating enzyme pair DesVII/DesVIII in Saccharopolyspora erythraea. (Appl Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative glycosyltransferase [SnogZ]
MRVMFTVSSWPTHYASLVPLGWALQAAGHEVRVLCAPSQTDSVAHAGLTPVPVLDGLDVP
QWLRLQYYEEARQGIWPYPWLPPHPVTGEDMAALDEFDMAEYRATTGAEQAARAARGFDA
ALALAREWAPHLVLHDPVSLEGLLAARVLGVPSALCLWGPVGPHEPEHMRVVPDDHSGSF
ARHGLGAFHLGMIERVVDPCPATLEPKAEAPRLPVRYVPYNGGGHAPDVSLLSAPPGPGA
RPRILLTWSTALSMISGPRSYALPGLVRALEGVGCELLVTATARDLAALGPVPDSVRVLE
RAPLRLLAPACDLIVHHGGSGSTLTSLWAGVPQLFLTFASEQAATATRVATAGAARHLPG
HQADPATVRAAVTELLQDTSYRRSATALREEMFSRPSPAELVTTLEALAAG
selected fasta
>putative glycosyltransferase [SnogZ]
GTGCGCGTCATGTTCACCGTCTCCTCCTGGCCCACCCACTACGCCTCCCTCGTCCCCCTC
GGCTGGGCGCTGCAGGCCGCCGGGCACGAGGTACGGGTGCTGTGCGCCCCGTCGCAGACC
GACTCCGTCGCGCACGCGGGCCTGACTCCCGTACCGGTGCTCGACGGGCTCGACGTGCCG
CAGTGGCTGCGACTGCAGTACTACGAGGAGGCACGCCAGGGCATCTGGCCGTATCCGTGG
CTGCCGCCGCATCCGGTCACCGGGGAGGACATGGCCGCCCTGGACGAATTCGACATGGCC
GAGTACCGGGCCACCACCGGCGCCGAGCAGGCCGCGCGGGCCGCCCGGGGCTTCGACGCC
GCCCTCGCCCTGGCCCGGGAGTGGGCGCCGCACCTGGTGCTCCATGACCCGGTGAGCCTG
GAAGGGCTGCTGGCCGCGCGCGTACTCGGTGTGCCGTCCGCGCTCTGTCTGTGGGGGCCG
GTCGGTCCCCACGAGCCCGAGCACATGCGCGTCGTGCCGGACGACCACAGCGGTTCCTTC
GCCCGTCACGGCCTCGGCGCGTTCCATCTCGGCATGATCGAGCGCGTCGTCGACCCCTGC
CCGGCCACCCTGGAGCCCAAGGCGGAGGCCCCCCGGCTGCCGGTGCGCTACGTCCCTTAC
AACGGCGGCGGCCACGCGCCGGACGTGTCGCTGCTCTCCGCACCGCCCGGGCCGGGCGCC
CGGCCGCGGATCCTGCTGACCTGGTCGACCGCGCTGTCCATGATCTCCGGGCCCCGGTCC
TACGCGCTGCCCGGCCTGGTGCGCGCTCTCGAGGGGGTCGGCTGCGAGCTCCTGGTGACC
GCGACGGCCCGGGACCTGGCGGCGCTCGGACCCGTGCCGGACTCGGTGCGGGTGCTGGAG
CGCGCACCGCTGCGGCTGCTCGCCCCGGCCTGCGACCTGATCGTGCACCACGGTGGCAGC
GGCAGCACGCTGACCTCGCTGTGGGCGGGAGTGCCTCAGCTGTTCCTCACCTTCGCCTCC
GAACAGGCCGCCACCGCCACCCGGGTGGCCACCGCCGGAGCGGCACGGCACCTGCCAGGG
CACCAGGCCGACCCGGCGACGGTGCGCGCGGCCGTGACCGAGCTGCTCCAGGACACCTCC
TACCGCCGGTCCGCCACCGCGTTACGCGAGGAAATGTTCAGCCGGCCCTCCCCGGCCGAG
CTGGTGACGACGCTGGAGGCACTGGCGGCGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [309-388]  1.8e-06 PF00201
PF00201   UDPGT
IPR010610 Domain of unknown function DUF1205 (Domain)
 [197-297]  5.20000000000001e-24 PF06722
PF06722   DUF1205
SignalP
 [1-28]  0.94 Signal
Eukaryota   
 [1-15]  0.443 Signal
Bacteria, Gram-negative   
 [1-26]  0.381 Signal
Bacteria, Gram-positive   
TMHMM No significant hit