close all open/close all

CDS information : Nogl_00430


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction46,854 / 44,515 / - [in whole cluster]
18,152 / 15,813 / - [in contig]
Locationcomplement(44515..46854) [in whole cluster]
complement(15813..18152) [in contig]
TypeCDS
Length2,340 bp (779 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productputative UvrA-like protein
Product (GenBank)SnorO
Gene
Gene (GenBank)snorO
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
B5LSY9
PmId
[20534129] Two heterologously expressed Planobispora rosea proteins cooperatively induce Streptomyces lividans thiostrepton uptake and storage from the extracellular medium. (Microb Cell Fact. , 2010)
ACC
Q54827
NITE
Adria_00370
PmId
[8655504] The Streptomyces peucetius drrC gene encodes a UvrA-like protein involved in daunorubicin resistance and production. (J Bacteriol. , 1996)
[9835035] The DrrC protein of Streptomyces peucetius, a UvrA-like protein, is a DNA-binding protein whose gene is induced by daunorubicin. (FEMS Microbiol Lett. , 1998)

close this sectionSequence

selected fasta
>putative UvrA-like protein [SnorO]
MSLRDDTDGTRGGPGTDPADSHDVIQVRGARENNLKRVSLDIPKRRLTVFTGVSGSGKSS
LVFDTIAAESRRLINETYTAFIQSFLPALARPDVDGLHNLSAAIVVDQERMGVNSRSTVG
TATDALEMLRIIFSRLSTPHVGGPGAFGFNSPDGMCRHCEGLGRVADIDVDQLVDRERSL
NEGAITVPGYAVGSWNWQIFAESGLLDPDLRLRDYSPDQWHDLMHKPATKIRHNSLNVTY
EGLLVKVRRTHLAKERESMQAHIRAFVERAVVFGPCPACGGARLNPAALAATVNGRNIAE
CSALQVSDLLDFVRGIDAAEVRPLTEALRGTLESMVEIGLGYLSLDRESGSLSGGEAQRV
KMVRHLGSSLTDVTYVFDEPTTGLHPHDVQRMNALLLRLRDKGNTVLVVEHKPEVIAIAD
HVVDLGPGAGDAGGQLCYAGDVPGLRASDTLTGRCLDHRVPLRAQPRRPRGHLAIRNASL
HNLKDVSVDIPLGVLTAVTGVAGSGKSSLIHGMLGHREGVVVVDQSPIRGSRRSSPATYT
KLFDGVRAAFARANGVSASLFSANSEGACPRCKGVGVVYTDLMMMADVASVCEECGGRRF
TPEVLSYTLRGRNISEVLGMSVTEARDFFPTGRVRASLDRLADVGLGYVGLGQPLNTLSG
GERQRLKLAVHMADQPTAYVLDEPTNGLHLADVDKLLTLLDRLVDGGNTVIVIEHHQAVM
AHADWLIDLGPGAGHDGGRVVFTGTPAELVETGDTLTAHHLRRYVGRARAQAEPVGAAR
selected fasta
>putative UvrA-like protein [SnorO]
ATGAGCCTCCGTGACGACACCGACGGCACCCGGGGCGGACCCGGCACCGACCCGGCGGAC
AGCCACGATGTGATCCAGGTGCGGGGCGCGCGCGAGAACAACCTGAAGAGAGTCTCCCTG
GACATCCCCAAACGGCGTCTGACGGTCTTCACCGGCGTCTCCGGCTCCGGTAAGTCCTCC
CTGGTCTTCGACACCATCGCCGCCGAGTCCCGGCGGCTGATCAATGAGACGTACACCGCG
TTCATCCAGTCGTTCCTGCCGGCCCTCGCGCGGCCCGACGTCGACGGGCTGCACAACCTC
AGCGCCGCCATCGTCGTCGACCAGGAGCGCATGGGGGTCAACTCCCGCTCCACCGTGGGC
ACCGCCACCGACGCGCTGGAGATGCTGCGGATCATCTTCAGCAGGCTCTCCACCCCGCAC
GTGGGCGGCCCCGGCGCCTTCGGTTTCAACAGCCCCGACGGCATGTGCCGGCACTGTGAG
GGCCTGGGGCGTGTCGCCGACATCGACGTCGATCAACTCGTCGACAGGGAGCGCTCCCTG
AACGAAGGGGCGATCACCGTGCCGGGCTACGCCGTCGGCTCCTGGAACTGGCAGATCTTC
GCCGAGTCGGGCCTGCTCGACCCCGACCTCAGGCTCCGGGACTACAGCCCCGACCAGTGG
CACGACCTCATGCACAAGCCCGCCACGAAGATCAGGCACAACAGCCTCAACGTCACCTAC
GAGGGGCTGCTGGTGAAGGTGCGCCGCACACACCTCGCCAAGGAACGGGAGTCCATGCAG
GCGCACATCCGGGCCTTCGTGGAGCGGGCCGTGGTCTTCGGCCCCTGCCCCGCGTGCGGC
GGGGCGCGGCTGAACCCGGCGGCACTGGCGGCCACCGTCAACGGCCGTAACATCGCCGAG
TGCTCCGCCCTGCAGGTCAGCGACCTGCTCGACTTCGTCCGCGGCATCGACGCCGCCGAG
GTGCGTCCCCTGACCGAGGCGCTGCGTGGCACCCTGGAGTCGATGGTGGAGATCGGCCTG
GGATATCTCAGCCTGGACCGCGAGTCGGGCAGCCTCTCCGGCGGCGAGGCCCAGCGGGTG
AAGATGGTCCGCCACCTCGGCTCCAGCCTCACCGACGTCACCTACGTCTTCGACGAGCCC
ACCACCGGACTGCACCCGCACGACGTCCAGCGGATGAACGCCCTGCTGCTGCGGCTGCGC
GACAAGGGCAACACGGTGCTGGTCGTCGAGCACAAGCCGGAGGTCATCGCCATCGCCGAC
CACGTCGTGGACCTCGGACCCGGCGCGGGCGATGCCGGGGGACAGCTCTGTTACGCCGGT
GACGTGCCCGGGCTGCGCGCTTCCGATACCCTCACCGGCCGCTGTCTCGACCACCGGGTG
CCCCTGCGTGCGCAACCCCGACGGCCTCGCGGACACCTGGCGATCAGGAACGCCTCGCTG
CACAACCTCAAGGACGTCAGCGTCGACATCCCGCTCGGGGTGCTCACCGCCGTCACGGGT
GTCGCCGGATCCGGCAAGAGTTCCCTGATCCACGGGATGCTGGGCCACCGGGAAGGGGTC
GTGGTGGTCGACCAGTCGCCGATCCGCGGCTCCCGGCGCAGCAGCCCCGCCACCTACACC
AAGCTCTTCGACGGGGTACGCGCCGCCTTCGCCCGGGCCAATGGGGTGAGCGCCTCGCTG
TTCAGCGCCAACTCCGAAGGAGCGTGCCCTCGCTGCAAAGGCGTCGGCGTCGTCTACACC
GACCTGATGATGATGGCGGACGTGGCGTCGGTCTGCGAGGAGTGCGGGGGCCGGCGCTTC
ACCCCCGAGGTGCTGTCGTACACGCTCCGCGGCAGGAACATCAGCGAGGTGCTCGGGATG
TCCGTGACCGAGGCCCGCGACTTCTTCCCCACCGGCCGCGTCCGTGCCTCGCTGGACCGG
CTGGCCGACGTGGGGCTGGGCTACGTGGGACTGGGGCAGCCGCTCAACACGCTCTCCGGC
GGGGAACGGCAGCGGCTGAAGCTGGCCGTGCACATGGCGGATCAGCCCACGGCCTACGTG
CTGGACGAGCCGACGAACGGCCTGCACCTCGCCGACGTGGACAAGCTCCTCACCCTGCTG
GACCGGCTCGTGGACGGCGGCAACACGGTCATCGTCATCGAGCACCACCAGGCCGTCATG
GCCCACGCCGACTGGCTCATCGACCTCGGCCCGGGCGCGGGCCACGACGGTGGGCGGGTC
GTCTTCACCGGCACGCCGGCCGAACTGGTGGAAACCGGTGACACGCTGACGGCACATCAT
CTGCGGCGGTACGTCGGCCGGGCCCGGGCACAGGCGGAGCCGGTCGGCGCGGCGCGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [638-686]  1.9e-10 PF00005
PF00005   ABC_tran
 [19-452]  PS50893 [462-756]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [44-429]  0.0150000018756781 SM00382 [492-763]  0.000110000029896148 SM00382
SM00382   AAA
SignalP
 [1-43]  0.064 Signal
Bacteria, Gram-negative   
TMHMM No significant hit