close all open/close all
Nogl_00430 Nogl_00430   last last

CDS information : Nogl_00440


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction47,108 / 48,172 / + [in whole cluster]
18,406 / 19,470 / + [in contig]
Location47108..48172 [in whole cluster]
18406..19470 [in contig]
TypeCDS
Length1,065 bp (354 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)SnoP
Gene
Gene (GenBank)snoP
EC number
Keyword
Note
  • This ORF is not involved in nogalamycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[22120896] Identification of late-stage glycosylation steps in the biosynthetic pathway of the anthracycline nogalamycin. (Chembiochem. , 2012)

close this sectionSequence

selected fasta
>[SnoP]
MHGEYKVPGGKLVVVDVDVEDGVLRHVRVAGDFFLEPDEALDAVNGALEGAPADTDAAGL
AARIDAALPAGTVMYGLTSEGVGIAVRRALARATDWTDYDWQLIHEAPQSPALHMALDEV
LTAEVAAGRRPPTLRVWEWGAPAVIIGSFQSLRNEVDAEGAARHGVEVVRRISGGGAMFV
EPGNTITYSLSVPESLVQGLSFQDSYAYLDDWVLGALGDLGIRAWYQPLNDIATDQGKIA
GAAQKRVVGPGGGPGAVLHHVTMSYDIDADKMVEVLRIGREKLSDKGTKSAKKRVDPLRR
QTGLPREAVIDRMIESFRARYGLAEGKVTDEELARAEELARTKFGSTEWTARVP
selected fasta
>[SnoP]
GTGCACGGTGAGTACAAGGTGCCCGGCGGCAAGCTCGTCGTCGTGGATGTGGACGTCGAG
GACGGCGTGCTGCGGCACGTGCGGGTGGCGGGTGACTTCTTCCTGGAGCCCGACGAGGCG
CTGGACGCGGTGAACGGCGCCCTGGAGGGCGCTCCTGCGGACACGGACGCGGCGGGGCTG
GCCGCGCGGATCGACGCGGCGCTGCCCGCGGGGACGGTGATGTACGGCCTGACCTCGGAA
GGGGTGGGCATCGCGGTGCGCCGGGCGCTGGCGCGCGCCACGGACTGGACCGACTACGAC
TGGCAGCTGATCCACGAGGCCCCGCAGTCGCCGGCCCTGCACATGGCGCTGGACGAGGTG
CTGACCGCCGAGGTGGCAGCGGGCCGGCGGCCGCCGACGCTGCGGGTGTGGGAGTGGGGC
GCCCCGGCCGTGATCATCGGCAGCTTCCAGTCGCTGCGCAACGAGGTCGACGCGGAGGGC
GCCGCCCGGCACGGCGTCGAGGTGGTGCGGCGGATCTCCGGCGGCGGCGCGATGTTCGTG
GAGCCCGGCAACACGATCACCTACTCGCTGTCGGTGCCCGAGTCCCTCGTCCAGGGTCTG
TCCTTCCAGGACAGCTACGCCTATCTGGACGACTGGGTGCTGGGCGCCCTCGGCGATCTG
GGCATCCGGGCCTGGTACCAGCCGCTGAACGACATCGCCACCGACCAGGGCAAGATCGCG
GGCGCGGCGCAGAAGCGCGTGGTCGGGCCCGGCGGGGGTCCGGGTGCCGTGCTGCACCAC
GTGACGATGTCGTACGACATCGACGCCGACAAGATGGTCGAGGTGCTGCGGATCGGGCGG
GAGAAGCTGTCCGACAAGGGCACGAAGAGCGCGAAGAAGCGGGTCGATCCGTTGCGCCGG
CAGACGGGGCTGCCGCGCGAGGCCGTCATCGACCGGATGATCGAGTCCTTCCGCGCGCGC
TACGGCCTGGCCGAGGGCAAGGTCACCGACGAGGAGCTGGCACGGGCGGAGGAGCTGGCC
CGCACGAAGTTCGGCTCGACGGAGTGGACGGCGCGCGTGCCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004143 Biotin/lipoate A/B protein ligase (Domain)
 [146-268]  1.6e-23 PF03099
PF03099   BPL_LplA_LipB
SignalP No significant hit
TMHMM No significant hit
Nogl_00430 Nogl_00430   last last