close all open/close all
first first   Nysta_00020 Nysta_00020

CDS information : Nysta_00010


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction783 / 46 / - [in whole cluster]
783 / 46 / - [in contig]
Locationcomplement(46..783) [in whole cluster]
complement(46..783) [in contig]
TypeCDS
Length738 bp (245 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative phosphopantetheinyl transferase
Product (GenBank)NysF
Gene
Gene (GenBank)nysF
EC number
Keyword
Note
Note (GenBank)
  • putative 4'-phosphopantheteine transferase
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
Related Reference
ACC
Q58J51
PmId
[15990252] An unexpected role for the putative 4'-phosphopantetheinyl transferase-encoding gene nysF in the regulation of nystatin biosynthesis in Streptomyces noursei ATCC 11455. (FEMS Microbiol Lett. , 2005)
ACC
Q9F0Q6
PmId
[11451672] Cloning and characterization of a phosphopantetheinyl transferase from Streptomyces verticillus ATCC15003, the producer of the hybrid peptide-polyketide antitumor drug bleomycin. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase [NysF]
MIELILPATVATEAAYDDRPRPGDRLLSSEREVIARAVESRQREFTTVRHLARRALRRLG
HPDRAILPNRRGAPQWPPGIVGSMTHCAGYRAAAVSPAELSAAVSIDAEPNGPLPAGVLN
AIALPSERPHLVALAAHRPDVHWDRLLFSAKESVFKAWYPLTQRELDFSEAEIVIDPTQG
AFTARLLVPGPLLGGRRVTVFPGRWHSTPALLTTAVHLPAPTPRRDREHRTHLTVNSPLP
RPTFG
selected fasta
>putative phosphopantetheinyl transferase [NysF]
GTGATCGAACTGATCCTGCCCGCCACGGTCGCCACCGAGGCGGCGTACGACGACCGGCCG
CGCCCCGGCGACCGGCTGCTCTCCTCGGAACGCGAGGTCATCGCCCGGGCCGTGGAGTCC
CGGCAGCGCGAGTTCACCACCGTCCGCCATCTCGCCCGCCGGGCCCTGCGCCGGCTCGGC
CACCCGGACCGGGCCATACTGCCCAATCGGCGCGGCGCCCCGCAGTGGCCGCCGGGCATC
GTCGGCAGCATGACGCACTGCGCCGGCTACCGCGCCGCCGCCGTCTCCCCCGCGGAGCTG
TCGGCCGCGGTGAGCATCGACGCCGAACCGAACGGTCCGCTGCCGGCCGGCGTCCTGAAC
GCCATCGCCCTGCCCTCGGAACGGCCGCACCTCGTGGCCCTGGCGGCCCATCGTCCGGAC
GTCCACTGGGACCGGCTGCTCTTCAGCGCCAAGGAGAGCGTCTTCAAGGCGTGGTATCCC
CTGACCCAGCGCGAACTGGACTTCTCCGAGGCCGAGATCGTCATCGACCCGACACAGGGC
GCCTTCACCGCCCGACTCCTGGTCCCGGGCCCCCTGCTGGGCGGTCGCCGGGTCACGGTC
TTCCCCGGCCGCTGGCACAGCACCCCCGCCCTGCTGACCACGGCGGTCCACCTGCCGGCC
CCCACCCCCCGGCGCGACCGGGAACACCGCACGCACCTCACGGTCAACTCGCCGCTCCCG
CGCCCCACCTTCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003542 Enterobactin synthetase-like, component D (Family)
 [39-59]  1.2e-22 PR01399 [69-87]  1.2e-22 PR01399 [146-162]  1.2e-22 PR01399
PR01399   ENTSNTHTASED
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [104-173]  3e-13 PF01648
PF01648   ACPS
 [119-182]  0.00042 G3DSA:3.90.470.20
G3DSA:3.90.470.20   no description
 [100-220]  1.1e-11 SSF56214
SSF56214   4'-phosphopantetheinyl transferase
SignalP No significant hit
TMHMM No significant hit
first first   Nysta_00020 Nysta_00020