close all open/close all

CDS information : Nysta_00020


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction2,684 / 867 / - [in whole cluster]
2,684 / 867 / - [in contig]
Locationcomplement(867..2684) [in whole cluster]
complement(867..2684) [in contig]
TypeCDS
Length1,818 bp (605 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
ProductABC transporter ATP-binding/permease protein
Product (GenBank)NysG
Gene
Gene (GenBank)nysG
EC number
Keyword
Note
Note (GenBank)
  • putative transporter (ABC family)
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[16251298] Nystatin biosynthesis and transport: nysH and nysG genes encoding a putative ABC transporter system in Streptomyces noursei ATCC 11455 are required for efficient conversion of 10-deoxynystatin to nystatin. (Antimicrob Agents Chemother. , 2005)

close this sectionSequence

selected fasta
>ABC transporter ATP-binding/permease protein [NysG]
MASPDDLEEERTAPRPARRLVGLLRPHRRSVALAVSMGVGGIVLNAFGPLLLGRVTDLIA
DGVLGGVPGPAPGIDFAAIGRLLLVLLALYVVASLFMLAQGRLVASAVWRTIHELRRDAR
EKLTRLPLRHFDRQPAGELLSRTTNDIDNLQQTLQQTLAELITSIFSLLTMLVLMLVISP
SLAVVMLLSVPVSALIAARISKRAQPHYAAQWSANGTLNAHVEEVCTGHALIKGFDRRAA
AEERFDACNDAVYRAAAKAQFASGAMEPVMMFVANLGYVLVAVIGAWKVINGTLTLGDVQ
AFILYARQFSQPIVEIASVAGRLQSGIASAQRVFTLLDAPEQAPDPLRPGTPARAEGRVE
FTDVSFRYSPDTPLIENLSLTVEPGSTVAIVGPTGAGKTTLGNLLMRFYEPDSGRILLDG
TDTATMTRDDLRSRFGLVLQDTWLFGGTIAENIAYGAPGACRADIEEAARATCADRFIRT
LPQGYDTVLDDESGTVSAGEKQLLTVARAFLARPAVLVLDEATSSVDTRTEVLIQRAMNS
LRAGRTSFVIAHRLSTIRDADLIVVMDAGRIVEQGTHDQLLCAQGLYARLHAARTHTPTA
GAAAG
selected fasta
>ABC transporter ATP-binding/permease protein [NysG]
ATGGCCTCGCCGGACGACCTTGAGGAGGAGCGGACCGCGCCCCGGCCGGCACGTCGGCTC
GTCGGCCTGCTGCGTCCGCACCGCCGCTCCGTGGCACTCGCCGTGTCGATGGGCGTCGGC
GGGATCGTGCTCAACGCGTTCGGCCCGCTGCTGCTCGGCCGGGTCACCGATCTGATCGCC
GACGGCGTGCTCGGCGGCGTCCCGGGCCCGGCGCCCGGGATCGACTTCGCCGCGATCGGC
CGGCTGCTGCTGGTCCTGCTGGCGCTCTACGTCGTGGCGTCGCTGTTCATGCTGGCGCAG
GGCCGGCTGGTGGCGTCCGCGGTGTGGCGCACCATCCACGAACTGCGCCGCGACGCCCGG
GAGAAGCTGACCCGGCTGCCGCTGCGCCACTTCGACCGGCAGCCGGCCGGTGAGCTGCTC
AGCCGCACCACCAACGACATCGACAACCTCCAACAGACCCTCCAGCAGACCCTCGCCGAG
CTGATCACCTCGATCTTCTCGCTGTTGACGATGCTGGTGCTGATGCTGGTGATCTCGCCG
TCGCTGGCCGTGGTGATGCTGCTCAGCGTGCCGGTCTCGGCGTTGATCGCGGCCCGGATC
AGCAAGCGCGCGCAGCCCCACTACGCCGCGCAGTGGTCCGCGAACGGCACCCTCAACGCC
CATGTGGAGGAGGTGTGCACCGGTCATGCGCTGATCAAGGGCTTCGACCGGCGCGCGGCG
GCCGAGGAGCGCTTCGACGCCTGCAACGACGCGGTCTACCGGGCTGCGGCCAAGGCGCAG
TTCGCCTCCGGTGCCATGGAACCGGTCATGATGTTCGTCGCCAACCTCGGCTATGTGCTG
GTGGCCGTCATCGGCGCCTGGAAGGTCATAAACGGCACCCTGACCCTCGGTGACGTGCAG
GCGTTCATCCTCTACGCCCGCCAGTTCAGCCAGCCGATCGTGGAGATCGCCTCGGTGGCG
GGCCGGCTCCAGTCCGGCATCGCCTCCGCCCAGCGCGTCTTCACCCTGCTCGACGCCCCC
GAGCAGGCCCCGGACCCGCTCCGGCCCGGCACGCCCGCCCGCGCCGAGGGCCGCGTCGAG
TTCACCGACGTGTCCTTCCGCTACTCCCCCGACACGCCCCTCATCGAGAACCTCTCGCTG
ACCGTGGAACCGGGCAGCACCGTGGCGATCGTCGGCCCCACCGGCGCCGGCAAAACCACC
CTCGGCAACCTCCTGATGCGCTTCTACGAACCGGACTCCGGCCGCATCCTCCTGGACGGC
ACCGACACCGCGACGATGACCCGCGACGACCTGCGGTCCCGCTTCGGGCTGGTGCTCCAG
GACACCTGGCTGTTCGGCGGCACCATCGCGGAGAACATCGCGTACGGCGCACCCGGTGCC
TGCCGTGCGGACATCGAGGAGGCGGCCCGCGCGACCTGTGCCGACCGCTTCATCCGCACC
CTGCCGCAGGGCTACGACACCGTGCTGGACGACGAGTCGGGCACCGTCAGCGCCGGCGAG
AAGCAGCTGCTGACCGTGGCCCGGGCCTTCCTCGCCAGACCGGCCGTCCTCGTGCTGGAC
GAGGCCACCAGCTCCGTGGACACCCGGACCGAGGTCCTGATCCAACGCGCCATGAACTCC
CTGCGGGCGGGCCGGACCAGCTTCGTGATCGCGCACCGCCTGTCCACGATCCGCGACGCG
GACCTGATCGTCGTGATGGACGCCGGCCGCATCGTCGAGCAGGGCACCCACGATCAACTC
CTGTGCGCGCAGGGCCTGTACGCCCGGCTGCACGCAGCCCGCACCCACACTCCCACCGCG
GGCGCCGCGGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [34-312]  6.6e-46 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [359-593]  22.642 PS50893
PS50893   ABC_TRANSPORTER_2
 [399-524]  1.4e-16 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [384-570]  4.1e-15 SM00382
SM00382   ATPases associated with a variety of cellula
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [14-340]  3.4e-80 SSF90123
SSF90123   ABC transporter transmembrane region
IPR017871 ABC transporter, conserved site (Conserved_site)
 [496-510]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [32-325]  52.636 PS50929
PS50929   ABC_TM1F
SignalP
 [1-1]  Signal-anchor
Eukaryota   
 [1-34]  0.419 Signal
Bacteria, Gram-positive   
TMHMM
 [31-53]  Transmembrane (i-o) [77-99]  Transmembrane (o-i) [165-187]  Transmembrane (i-o)
Transmembrane 3