close all open/close all

CDS information : Nysta_00030


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction4,416 / 2,662 / - [in whole cluster]
4,416 / 2,662 / - [in contig]
Locationcomplement(2662..4416) [in whole cluster]
complement(2662..4416) [in contig]
TypeCDS
Length1,755 bp (584 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
ProductABC transporter ATP-binding/permease protein
Product (GenBank)NysH
Gene
Gene (GenBank)nysH
EC number
Keyword
Note
Note (GenBank)
  • putative transporter (ABC family)
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[16251298] Nystatin biosynthesis and transport: nysH and nysG genes encoding a putative ABC transporter system in Streptomyces noursei ATCC 11455 are required for efficient conversion of 10-deoxynystatin to nystatin. (Antimicrob Agents Chemother. , 2005)

close this sectionSequence

selected fasta
>ABC transporter ATP-binding/permease protein [NysH]
MLLRLLRAQLRPYAWATAALVALQLVQILGTLLLPTLGAALIDQGVVRGDGGRITELGVV
MGVVALVQIAAALGAAALAARTATAMGRDLRSALFRRILDFSAREIGRFGTPSLLTRSVN
DVQQVQNLAQTGFGIVVCAPLMCLGSVLLALRQDVPLALLLVALVLVVAVCFGLLLARMG
TLYARMQLTLDRLGRLLREAITGVRVVRSFVRDDHERARFAQTNDAFLVVSRRVGRLIAT
MLPVVLLLMNGFTVALLWTGSHRIDAGRMPIGSLSALLSYLSLILMSVVMLAFVFLSVPR
ARVCAGRIAEVLDTGSSVAPPAAPQPVRGPAGRIELCAAGYRYPGAEEPVLRDVDLTVEP
GERIAVLGSTGSGKTTLLNLVLRLADATEGAVRVGGTDVRELTAATLAAAVGFVPQRPYL
FSGTVASNLRFGRPDATDEELWEALRVAQAADFVARMPDGLDAEITQGGGNVSGGQRQRL
SLARALLRRPEIYLFDDCFSALDQATDAALRTALVPYTAGATVITVAQRISAGRDADRIV
VLDRGRVVAQGTHDVLLRTSPTYREIALSQLTEEEAAHGLAGRP
selected fasta
>ABC transporter ATP-binding/permease protein [NysH]
GTGCTGTTGAGACTTCTGCGGGCACAGCTGCGCCCCTACGCCTGGGCCACCGCCGCTCTC
GTCGCCCTTCAACTCGTCCAGATCCTGGGCACTTTGCTGCTGCCGACGCTGGGCGCCGCA
CTTATCGACCAGGGGGTGGTGCGCGGCGACGGCGGGCGCATCACCGAGCTGGGTGTGGTG
ATGGGCGTGGTGGCGCTGGTGCAGATCGCCGCCGCGCTCGGTGCGGCCGCGCTGGCCGCC
CGGACCGCGACGGCGATGGGCCGCGATCTGCGGTCCGCGCTCTTCCGCCGCATCCTGGAC
TTCTCCGCCCGCGAGATCGGCCGGTTCGGCACCCCCTCCCTGCTGACCCGGTCGGTGAAC
GACGTGCAGCAGGTGCAGAACCTCGCCCAGACCGGCTTCGGCATCGTCGTCTGCGCGCCG
CTGATGTGCCTGGGCAGCGTGCTGCTGGCGCTGCGCCAGGACGTTCCGCTGGCACTGCTG
CTGGTGGCGCTGGTGCTGGTGGTGGCGGTCTGCTTCGGCCTGCTGCTGGCCCGGATGGGC
ACCCTGTACGCGCGGATGCAGCTGACCCTGGACCGGCTGGGGCGGCTGCTGCGCGAGGCG
ATCACCGGGGTGCGGGTGGTCCGGTCCTTCGTCCGCGACGACCACGAGCGCGCGCGGTTC
GCGCAGACCAACGACGCGTTCCTCGTGGTGTCGCGGCGGGTGGGTCGGCTGATCGCGACG
ATGCTGCCGGTCGTGCTGCTGCTGATGAACGGTTTCACCGTAGCCCTGCTGTGGACCGGC
TCCCACCGGATCGACGCGGGCCGGATGCCGATCGGCTCGCTCAGCGCCCTCCTGAGCTAT
CTCTCGCTGATCCTGATGTCCGTCGTGATGCTCGCCTTCGTGTTCCTGTCGGTGCCGCGG
GCCCGGGTCTGTGCCGGCCGGATCGCGGAGGTCCTGGACACCGGGTCGAGCGTGGCGCCG
CCGGCCGCGCCGCAGCCGGTGCGCGGGCCCGCCGGCCGGATCGAACTGTGCGCGGCCGGG
TACCGCTACCCGGGCGCCGAGGAGCCCGTGCTGCGGGACGTCGACCTGACCGTCGAGCCG
GGCGAGCGGATCGCCGTGCTCGGCAGCACCGGCAGCGGCAAGACGACCCTGTTGAACTTG
GTGCTGCGGCTGGCCGACGCCACCGAGGGCGCGGTGCGGGTCGGCGGCACCGACGTCCGC
GAGCTGACCGCGGCCACGCTCGCCGCCGCCGTCGGGTTCGTGCCGCAGCGGCCGTACCTG
TTCTCCGGCACCGTGGCGAGCAATCTGCGCTTCGGGCGGCCGGACGCCACCGACGAGGAG
CTGTGGGAGGCGCTGCGGGTCGCCCAGGCGGCCGACTTCGTGGCGCGGATGCCGGACGGC
CTCGACGCGGAGATCACCCAGGGCGGCGGCAATGTCTCCGGCGGCCAGCGCCAACGCCTG
TCCCTCGCCCGGGCGTTGCTGCGCCGGCCGGAGATCTATCTCTTCGACGACTGTTTCTCG
GCGCTCGACCAGGCCACCGATGCGGCGCTGCGGACCGCGCTGGTGCCGTACACCGCGGGC
GCCACGGTGATCACCGTGGCGCAGCGGATCTCCGCCGGCCGCGACGCGGACCGGATCGTG
GTGCTGGACCGCGGGCGCGTGGTCGCCCAGGGCACCCACGACGTGCTGCTGCGCACCAGC
CCGACCTACCGCGAGATCGCGCTCTCGCAGCTGACCGAGGAGGAAGCCGCCCATGGCCTC
GCCGGACGACCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [25-288]  1.1e-28 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [375-499]  2.2e-19 PF00005
PF00005   ABC_tran
 [334-569]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [360-546]  2.10000267834031e-17 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [6-313]  3.99998544139406e-57 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [472-486]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [18-300]  PS50929
PS50929   ABC_TM1F
SignalP
 [1-40]  0.811 Signal
Eukaryota   
TMHMM
 [20-42]  Transmembrane (i-o) [57-79]  Transmembrane (o-i) [132-151]  Transmembrane (i-o) [155-177]  Transmembrane (o-i) [234-256]  Transmembrane (i-o) [276-298]  Transmembrane (o-i)
Transmembrane 6