close all open/close all

CDS information : Nysta_00040


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction4,714 / 5,748 / + [in whole cluster]
4,714 / 5,748 / + [in contig]
Location4714..5748 [in whole cluster]
4714..5748 [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductGDP-mannose 4,6-dehydratase
GDP-D-mannose dehydratase
Product (GenBank)NysDIII
GenenysDIII
gmd
Gene (GenBank)nysDIII
EC number4.2.1.47
Keyword
  • mycosamine
Note
Note (GenBank)
  • putative dGDP-mannose-4,6-dehydratase
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[17905880] Analysis of the mycosamine biosynthesis and attachment genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455. (Appl Environ Microbiol. , 2007)
Related Reference
ACC
Q6T1X7
PmId
[11096116] Identification of two GDP-6-deoxy-D-lyxo-4-hexulose reductases synthesizing GDP-D-rhamnose in Aneurinibacillus thermoaerophilus L420-91T. (J Biol Chem. , 2001)
ACC
P93031
PmId
[9050909] The MUR1 gene of Arabidopsis thaliana encodes an isoform of GDP-D-mannose-4,6-dehydratase, catalyzing the first step in the de novo synthesis of GDP-L-fucose. (Proc Natl Acad Sci U S A. , 1997)
[12881408] Interaction of GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase with GDP-mannose-4,6-dehydratase stabilizes the enzyme activity for formation of GDP-fucose from GDP-mannose. (Glycobiology. , 2003)

close this sectionSequence

selected fasta
>GDP-mannose 4,6-dehydratase [NysDIII]
MSKRALITGITGQDGSYLAEHLLSQGYQVWGLIRGQANPRKSRVSRLASELDFIDGDLMD
QGSLVSAVDTVQPDEVYNLGAISFVPMSWQQAELVTEVNGMGVLRMLEAIRMVSGLSTSR
TVSPRGQIRFYQASSSEMFGKAAETPQRETTLFHPRSPYGAAKAYGHYITRNYRESFGMY
AVSGMLFNHESPRRGQEFVTRKISLAVARIKQGLQDKLALGNLDAVRDWGYAGDYVRAMH
LMLQQDAGDDYVIGTGQMHSVRDAVRIAFEHVGLNWEDYVVIDPDLVRPAEVEVLCADSA
KAQDRLGWKPDVDFPTLMRMMVDSDLAQVSRENQYGDVLLAANW
selected fasta
>GDP-mannose 4,6-dehydratase [NysDIII]
ATGTCCAAACGAGCGCTGATCACCGGAATCACCGGCCAGGACGGCTCCTATCTCGCGGAG
CACCTGCTGTCCCAGGGCTACCAGGTGTGGGGTCTGATCCGCGGCCAGGCCAATCCCCGC
AAGTCCCGGGTCAGCCGCCTCGCCTCCGAACTCGACTTCATCGACGGGGACCTGATGGAC
CAGGGCAGCCTGGTCTCCGCCGTCGACACCGTGCAGCCCGACGAGGTCTACAACCTCGGC
GCCATCTCGTTCGTGCCGATGTCCTGGCAGCAGGCCGAGCTGGTCACCGAGGTCAACGGC
ATGGGCGTGCTGCGCATGCTGGAAGCCATCCGCATGGTCAGCGGACTGTCCACCTCCCGC
ACGGTCAGCCCGCGCGGCCAGATCCGCTTCTACCAGGCGTCCAGCTCGGAGATGTTCGGC
AAGGCCGCCGAGACGCCGCAGCGCGAGACCACCCTCTTCCACCCGCGCAGCCCCTACGGC
GCGGCAAAGGCGTACGGGCACTACATCACCCGCAACTACCGCGAGTCCTTCGGCATGTAC
GCGGTCTCCGGCATGCTCTTCAACCACGAATCCCCGCGCCGCGGCCAGGAATTCGTCACC
CGCAAGATCAGCCTGGCGGTCGCCCGCATCAAGCAAGGCCTCCAGGACAAGCTGGCACTC
GGCAACCTCGACGCGGTGCGCGACTGGGGCTATGCCGGCGACTACGTCCGCGCCATGCAC
CTGATGCTCCAGCAGGACGCCGGCGACGACTACGTCATCGGCACCGGGCAGATGCACTCG
GTGCGCGACGCGGTTCGGATCGCGTTCGAACACGTCGGCCTGAACTGGGAGGACTACGTC
GTCATCGACCCCGACCTGGTGCGGCCCGCCGAGGTCGAGGTGCTGTGCGCCGACAGCGCC
AAGGCCCAGGACCGCCTCGGCTGGAAGCCGGACGTCGACTTCCCCACCCTCATGCGCATG
ATGGTCGATTCCGACCTGGCGCAGGTTTCCCGCGAAAACCAATACGGCGACGTGCTGCTC
GCCGCCAACTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [5-254]  1.99999999999999e-63 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [2-192]  7.69999999999997e-45 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit