close all open/close all

CDS information : Nysta_00050


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction5,930 / 34,363 / + [in whole cluster]
5,930 / 34,363 / + [in contig]
Location5930..34363 [in whole cluster]
5930..34363 [in contig]
TypeCDS
Length28,434 bp (9,477 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NysI
Gene
Gene (GenBank)nysI
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)

close this sectionPKS/NRPS Module

9 malonyl-CoA
10 malonyl-CoA
11 methylmalonyl-CoA
12 malonyl-CoA
13 malonyl-CoA
14 malonyl-CoA
KS34..398
AT571..886
DH936..1117
KR1443..1619
ACP1720..1790
KS1813..2187
AT2345..2662
dh
KR2983..3162
ACP3266..3336
KS3357..3730
AT3895..4215
dh
KR4523..4703
ACP4806..4876
KS4901..5276
AT5430..5752
dh
KR6068..6247
ACP6348..6418
KS6454..6823
AT6971..7289
dh
kr7535..7710
ACP7813..7883
KS7908..8271
AT8429..8738
dh
KR9050..9229
ACP9331..9401

close this sectionSequence

selected fasta
>polyketide synthase [NysI]
MDNEQKLRDYLKLATADLRRTRRRVHKLESAAQEPVAIIGMTCRYPGGVRSPEDLWRMVE
AGEHGVTPFPTDRGWDLEALAAAPTASGGFLHDAPDFDADFFGISPREAVAMDPQQRVVL
ESAWEAFERAGIDPTSVKGSRTGVFIGAMAQDYRVGPADGAEGFQLTGNTGSVLSGRISY
TFGTVGPAVTVDTACSSSLVAVHLATQALRAGECTLALAGGVTIMSGPGTFIEMGRQGGL
SADGRCRSFGDTADGTGWAEGVGILVLERLSDAVRNGHEILAVVRGTAVNQDGASNGLTA
PNGPSQQQVIQQALVNARLAAGDIDVVEAHGTGTTLGDPVEAQALLATYGQNRPADRPLL
LGSVKSNLSHTQAAAGVAGVIKMVMAMRHGTLPRTLHAEEPTHHVDWSQGAVRLLTDTTD
WPATGAPRRAAVSSFGISGTNAHTIIEQAPEPQPEDAATAQDDAAGSTPATAPVVPGVVP
VLLSGRTPDALRGQAAALRAALDTGRRPDLLDLAHSLATTRAGFEHRAVLLATDHPALTD
GLTALADADDPAAAPAWITGTTRAETRLAVLFTGQGAQRLGAGRELAARFPAFATALDAA
LDAFTPHLDRPLREVLWGTDAALLDRTAYAQPALFAVEVALYRLIESFGVRPDHLAGHSV
GEIVAAHLAGVLSLADAATLVAARGRLMQALPDGGAMIAVQASEADVAPLLAGHEDQVAI
AAVNGPSAVVLSGAEATVTALAEQLAADGRKTRRLRVSHAFHSPLMEPMLDAFRAVVEDL
TLQPPLLPVVSNLTGKPATVAQLTSADYWVDHVRHAVRFADGIDWLARHDTTAFLELGPD
GVLSAMAQDCLDAADADAVTLPALRAGRPEEHTLTTALAGLHVHGATLDWTGCFAGTGAR
RTDLPTYAFQRRRYWPKALQSGTADLRSVGLGAAHHPLLSAAVSLADAGGTLLTGRLSRQ
THPWLADHTVRGTTLLPGTAFLELAVRAGDEVGCDRVEELTLAAPLLLPEQGGVQVQLWI
GNPDVSGRRTVNVHARPDTGDDTPWTAHATGVLTTADASRQLPASSEQGGTPLAGDPHPA
LDAAQWPPAGAEPLPLDGHYDRLADGGFGYGPVFQGLRAAWRGGDVVYAEVELPEAGRSD
AEAFGLHPALLDAALHAAPFTGLGERGRGGLPFSWEGVSLHAGGATTLRVRLTPVADDAL
ALTVADGTGAPVLSVDSLVLRSVATQQLDTAAAVARDALFRLDWTPVQPTATDPGPVALL
GADPFGLLTHAGFADAPAYPDLAALAAADGPVPTTVVLSLAGTGDDAADPARSAHRCAAE
ALAAVQTWLDHHERFAAARLVFVTRGATVGRDVAAAAVWGLVRSAQSENPGCFALVDLDP
DGAVGAAALVAALVSGEPQLAVRGDVLRVARLVRRPLTEVGAGADGTGDGVGDGSGVSFS
GEGAVLVTGGTGGLGAVLARHLVAEYGVRDLLLVSRSGERAVGAGELVAELAGVGARVRV
VACDVTDRAAVVELVGGHAVSAVVHAAGVLDDGMVGALTGERLSAVLRPKVDAVWHLHEA
TRGLDLDAFVVFSSLAGVFGSPGQANYAAANAFLDALMTRRRAEGLPGLSLAWGPWEQSG
GMTGTLTDVDAERLARSGVPPLSVAQGLALFDAAVAGTDATCVPVRLDLPVLRARGEVPP
LLRSLIRVRARRAAVAGSATAGNLAQRLRRLDEDGRDEMVLDLVRGQVALVLGHATGGDV
DAGRAFRDLGFDSLTAVELRNRLNTVTGLRLPATLVFDYPTVRHLATYVLDELLGTDAEV
ATVQPAAVAVADDPIVIVGMACRYPGGVSSPEDLWRVLTEGTDAVSGFPTNRGWDVESLY
HPDPDHPGTSYTRSGGFLHEAGEFDPGFFGMSPREALATDSQQRLLLESSWEAIERAGID
PVSLRGSRTGVFAGVMYSDYSAMLASPEFEGFQGSGSSPSLASGRVAYTLGLEGPAVTVD
TACSSSLVAMHWAMQALRSGECGLALAGGVTVMSTPAVFVDFARQRGLSPDGRCKAFADA
ADGVGWSEGVGVLVLERQSDAVRNGHEILAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQ
ALASGGLTAGDVDVVEAHGTGTTLGDPIEAQALLATYGRDREPERPLLLGSVKSNLGHTQ
AAAGVAGVIKMVLAMRHGVVPRTLHVDAPSSHVDWSEGAVELLSEQAAWPETGRVRRAGV
SSFGISGTNVHVIVEQAPGAKAIAAAGAARRTPGAVPVLLSGRGRSALRGQAARLLGHLQ
ARPDAELVDVALSLATTRSRFEQRAAVVAQDRDQLIASLGALAADRPDPAVVEGEAAGRG
RTAVLFTGQGSQRAAMGRELHEVQPEFAAAFDAVCAVFDPLLDRPLREVVFAEDGSDEAA
LLDETGWTQPALFAVEVALFRLVESWGVRPDFVAGHSIGEIAAAHVAGVLTLEDACRLVA
ARATLMQALPTGGAMIAIQATEDEIAAHLDDTVAIAAVNGPQSVVISGDEEAAETIAATF
AERGRKTKRLRVSHAFHSPRMDGMLDAFRIVAEGLTYRAPRIPLVSDLTGRRADDAEVCT
AEYWVRHVREAVRFADCVRTLRDAGATTFLELGSDGLLTAMAEDTLGDDHDAELVPMLRA
GRAEELAAATALARLQVRGVDVDWAAYLAGTGARRTDLPTYAFQHAYYWPQLPTPAAALA
AADPADQQLWAAVERGDARELADILGLGEQDLTPLDSLLPALTSWRRGNQEKHLLDTLRY
RVEWTRLSKPTAPVLDGTWLLVASDATAADQPALLDGLADALGSHGARVRRLLLDDSCAD
RAVLAERLARTADVDAATQVLSVLPLDERDADDCPPLTRGLALTVALVQALADTGAQGRL
WTATRGAVSTNPADPVTHPVQAAAWGLGRGVALEHPRLWGGLVDLPQVFDERAGQRLAGI
LAVKDAPDGEDQVALRATGVSGRRLVRHTVEALPTAAEFTATGTVLITGGTGGLGAEVAR
WLARAGAQHLVLTSRRGPDAPGAAELRAELEGYGPSVSVVACDVADRDALAAVLTALPEE
LPLTGVVHTAGVGHYGPLDTLSTAEFAGLTAAKLAGAAHLDALLADRELDFFVLFGSIAG
VWGSGNQSAYGAANAYLDALALHRRARGLAATSVAWGPWAEAGMAADDAVSETLRRQGLG
LLDPAPAMTELRRAVVRQDVTVTVADVDWQRYAPLFTSARPSALIAGLPEVRALAADERT
EQDATGASEVVTRVRALAEPEQLRLLTDLVRTESATVLGHSSADAVPEGRAFRDVGFDSL
TAVELRKRLGAATGLSLPSTMVFDYPTPLELAQYLRAEILGAVLEVAGPVATGGADDEPI
AIIGMACRFPGGVSSPEQLWDLVASGTDAISEFPVNRGWQTGHLFDPDPDRPGTTYSTQG
GFLHEADEFDPTFFGISPREALVMDPQQRLLLETTWESFERAGIRPETLRSTLTGTFVGS
SYQEYGLGAGDGTEGHMVTGSSPSVLSGRLSYVFGLEGPAVTVDTACSSSLVALHLACQS
LRNGESNLAVAGGATIMTTPNPFIAFSRQRALAKDGRCKAFSDDADGMTLAEGVGVVLVE
RLSDAQRNGHPVLAVLRGSAINQDGASNGLTAPNGPSQQRVIRQALANARLAPGDIDALE
AHGTGTPLGDPIEAQALFATYGRDRDPESALLLGSVKSNIGHTQSAAGIASVIKMVMALR
HSELPPTLHADAPSSHVDWSAGTVRLLTQARAWPETGRPRRAAVSSFGISGTNAHVLLEQ
APVADTPAEERPAVAPVPIAAGVVPWVVTARSAAALRGQAERLLAHAETVGTALPAAGPL
DIGLSLVSARARFEHRAVVVPPAGTDPLAALRAVATDGPSPVVARGVADVEGRTVFVFPG
QGSQWVGMGSQLLDESAVFAERIAECAAALAEFTDWSLVDVLRGVVGAPSLERVDVVQPA
SFAVMVSLAALWRSRGVLPDAVVGHSQGEIAAAVVSGALSLRDGARVVALRSQAIGRALA
GRGGMMSVALSVDVLEPRLVEFEGRVSVAAVNGPRSVVVAGEPEALDALHARLTADDIRA
RRIAVDYASHSHQVEDLHEELLEVLAELAPRTSEVPFFSTVTGDWLDTARMDAGYWFRNL
RGRVRFADAVADLLAAEYRAFVEVSSHPVLSMAVQEAIDEAGVPAVAAGTLRRDQGGTDR
FLLSAAEVFVRGVDVDWAGLFEGTGASRIDLPTYAFQHEHLWAVPPAPEAVAAADPDDAA
FWTAVEDGDVSALTAALGTDEDSVAAVLPALTSWRRARRDRSTVDAWRYRVAWKPLGGTL
PHPSLTGTWLLVTADGIDDTDVAGALETYGAEVRRLVLDEECVDRAVLRERLAGAEDVTG
IVSVLAAAERTDAVPGTSLVLGTALTVALIQALGDAEIDAPVWALTRGAVSTGRADELTA
PVQAQVTGIGWTAALEHPQRWGGTLDLPAALDARAAQRLAAVLSGALGSDDQLAIRPSGV
FTRRIVRAEATAGRPAGTWTPRGTTLVTGGSGTLAPHLARWLAQRGAEHLVLISRRGTAA
PGAAELVAELAESGTEATVAACDITDRDAVAALLADLKADGRTVRTVVHTAATIELHTLD
ATTLADFDRVLHAKVTGAQVLAELLDDEELDDFVLYSSTAGMWGSGAHAAYVAGNAYLAA
LAEHRRANGLPALSLSWGIWADDLKLGRVDPQMIRRSGLEFMDPQLALSGLQRALDDNEN
VLAVADVDWETYHPVYTSGRPTPLFDEVPEVRRLTAAAEQSAGTVAEGEFAAALRALSDA
EQQRTLLETVRTEAASVLGLSSAEDLTDQRAFRDVGFDSLTAVGLRNRLASVTGLTLPST
MVFDYPNPAALAAYLHGELAGARSAAAGAAAVPTGAPDADDPIAIVGMSCRYPGGVGSAE
DLWRIALDEVDAISGFPADRGWDAEGLYDPDPDRPGRTYSVQGGFLRDVAEFDPGFFGIS
PREALSMDPQQRLLLETAWEAFEHAGIDPVGQRGSRTGTFVGASYQDYASGVPNSEGSEG
HMITGTLSSVLSGRVSYLFGFEGPAVTLDTACSSSLVAMHLACQSLRNGESSLALAGGVS
IMSTPMSFVGFSRQRALAEDGRCKAYADGADGMTLAEGVGLVLLERLSDARANGHQVLAV
IRGSAVNQDGASNGLTAPNGPSQQRVIRQALANSAVAPGDIDVLEGHGTGTALGDPIEAQ
ALLATYGQDRAPERPLLLGSVKSNIGHTQMASGVASVIKLVRALQEGVVPKSLHIDRPST
HVDWSSGAIGLLTERTPWPETGRPRRAAVSSFGISGTNVHTILEQAPADEAPTPADPPRD
GLVPVLLSGRGEAALRAQAARLLAFVEERPEAHLTDLAHSLATSRAALERRAAVIAADRD
TLTRGLRALSDGRPDPGLVQGTAGRGRTAFLFTGQGSQRPGMGRELHDRYPVFADALDEV
LARLDDGPDRPLREVLFAAPDSAEAALLDRTGYAQPALFAVEVALFRLLTSWGLTPDYLA
GHSVGELAAAHVAGVLSLDDACTLVAARGRLMQALPEGGAMVALEAAEDEVLPLLEGLTD
RVSVAAVNGPRSVVVAGVEEDVLLLADLFAADGRRTKRLRVSHAFHSPLMDAMLDDFAAV
ARGLTYHPPTIPFVSNVSGGLATAEQVRTPDYWVGHVRAAVRFADGIDWLATQGDVHTFL
ELGPDGVLSAMARESLTDPSRTALLPTLRGDRPEEPALVTAVAAAHAHGARVDWSGYFAD
HGARRTTLPTYAFQRERYWPDTTAATSAHTPGSALDAEFWAAVERDDVAALAASLDLDDA
TVTAMVPALTAWRRRRGEQTELDSWRYRVTWKPRGGATAPAALTGRWLVLVPHDHQDRQD
DATAAWAADVETALGTTTVRLTVTTTDRAALAARITEAAGDQGPFSGVLSLLPLATGDAG
HPGAPAALTLTTTAVQALGDAGIDAPLWNVTRGAVAVGRAEQVTAPEQAAVWGLGRAVAL
ELPARFGGTLDLPATLDGQAARRLRAVLAATDGEDAVALRPSGVFLRRLAHAPAGPDTAR
TAFDPAAGTVLITGGTGGIGGHVARRLARDGATHLLLTSRRGPAAPGADALRAELEELGA
RVTLAACDAADRDALAALLAELPDDAPLCAVFHTAGVVEDHVVDALTPENFAAVLRAKTV
AAHHLHELTADLDLAAFVLFSSTAGVLGAAGQGNYAAANAHLDALAEHRRSHGLTALSVA
WGPWAGSGMVADAAELTDRVRRGGFEPLAPEPAVRALLRAIENDDTTVALADIDWERFQR
AFAAVRPLPFVADLPETGRATPATATGAATGLRQQLAELPEHERPAAVLDLLRTQVAAVL
GHADPRTVEDDHAFRDLGFDSLTILELRNALNAATGLSLPATLVYDLPTPREMADFLLAE
LLGTLPTDTAATVASTASPKLSASFEQGGTPFDDPIAVIGIGCRFPGGVTTPEELWQLLD
EGRDGISRFPDDRGWDLAALGAGASDTLEGGFLTGVADFDARFFGISPREALAMDPQQRL
LLETTWEALERAGIDPTTLRGSTTGVFVGTNGQDYPTLLRRSASDVAGYVATGNTASVMS
GRLSYALGLEGPAVTIDTACSSSLVALHWAGRALRAGECDLVVAGGVSVMASPDSFVEFS
TQGGLAPDGRCKAFSDAADGTAWSEGVGILVLERLSAARRNGHQVLGLIRGTAVNQDGAS
NGLTAPNGLSQQRVIAQALADARLRPADIDAIEAHGTGTTLGDPIEARALITAYGRDRDA
ERPLLLGTVKSNIGHTQAAAGAAGVIKMLMAMRHGTLPRTLHVGTPSSHVDWSGGTVALL
DDARPWPRTGQPRRAGVSAFGVSGTNAHVVVEQAPETEAPAAPAAEPAPEATPTVVPWVV
SGRSREALQAQLDRLTAHTAAHPARSAADVGRSLATDRTLFPHRAVLLAGPDGVREAARA
AAPRTPGRTAFLFSGQGAQHALMGHDLYQRFPVYADALDTVLAQFDTVLDVPLRAALFAA
PGTPEAALLDQTGFTQPALFAVEVALFRLAESWRLTPDFVAGHSIGEIAAAHVAGVFSLE
DACTLVAARASLMQQLPRDGAMVALEATEDEVAPLLTDGVALAAVNGPRSVVVAGAEDAV
RAVADRLAADGRRTRRLTVSHAFHSPLMDPMLTDFARVAEGLTYHEPRIPLVSTLLGAPA
GAELRTPDYWVRHVRETVRFADGVRALHDAGAGTFVEIGPDGVLTALTQQTLDTVEAGAP
AVVVPLQRRDRAGDLALLEGLATLHTHGTGPSWPAYFEATGGHRTDLPTYAFQRERYWPE
LGAPVATAPQDPAAWRYHETWAPLPAPEAAAPAGRALVLVPAGNRDTAWMTAVADALGAD
TVTAEPDALAEQLTAAGDTPWRVVVSLLAAASEGLPADGAWPAALLATLDEAGVHAPLWC
VTRGAVAVAGEAPTAVGQAALWGLGRVAALDHPDRFGGLADLPADTDAHAAGLLAAHLAA
PGTEAEIAVRATGVHARRLVRTPAAADGATWLPTGTVLVVGGTGGTGTMGGRAARWLVRE
GARHLVLTAPDGTTTAADTEALTAELAALGARITVVDHDPTAPDGFAALLDGLPDDTPLT
AVVYAPEADAAPGTAAELSAALAPVTALGAALTGRPLDAFVLFGSIAGLWGVRGRAAEAA
SGAYLDAFARACRDRGTPALAVAWGAWADLVGPSLAAHLRMNGLPVMDADTALTALSRAV
ADGSAAEAVADVRWETFAPLHHEARRTALFDALPEARGALAEAARDRADRKTAAGDYGRW
LAEQPAADHDAILLALVTEKAATVLGHADHDLLEPDLPFRDLGFDSLTAVDLRNQLTAET
GLTLPATLVFDHPNPAALAAHLRAQLLGEASDSAAPVAAPVALGADDDAIVIVGMACRYP
GGVTSPEDLWQLVGDEVDAVGDFPTDRGWDLAALAGDGPGRSATAQGGFLYDATDFDPGL
FGISPREALVMDPQQRILLETSWEALERAGIDPATLRGSGTTGVFVGGGSGDYRPPEEAG
QWQTAQSASLLSGRLAYTFGIQGPTVSVDTACSSSLVALHLAAQALRAGECSIALAGGVT
VMATPVGFVEFSAQGALSPDGRCRAFSDDANGTGWSEGVGMLVVERLSDARRNGHRVLAV
LRGSAINQDGASNGLTAPSGPAQQRVIRQALANARLRPADIDAVEAHGTGTRLGDPIEAQ
ALLATYGQDRERPVLLGSLKSNIGHTQAASGVGGVIKMVLAMQHGELPRSLYAENPSSHV
DWTAGRAHLLTARTPWPDSGRPRRAAVSSFGASGTNAHAILEQPPREELPARPADDGAPL
PFLLSGRSQNALRAQARRLLARLTAHPDTRAADLAYSLATTRAAFEHRAAITATDHDGLR
TGLTAVAEGTTAPHTAEHHLQGTGKRAVLFSGQGSQRLGMGRELHERHPVFAEAFDSVLA
RLDDRLDTPLRDVVWGTDEEALHATGNTQPALFAVEVALYRLIESWGVRPDFVAGHSVGE
LAAAHVAGVLSLDDACRLVAARAALMQRLPAGGAMIAVEATEDEVTPLLTDGVSLAAVNG
PTAVVLSGAGDAVTALGQALAERGHRTTRLRVSHAFHSHLMDPMLADFRTVAEGLEYHPP
RIPVVSNLTGDVADAADLCSADYWVRHVRGTVRFADGVRTMADRGVHLFLELGPDAVLSA
MARQCAPDAVVVPALRRNRDEDETLVGAVARLHVHGAGPRWDAYFAGRGAQWLDLPTYPF
QRGRFWPESLPGAASAAPAAGQPAETDAAFWDAVAQEDFTALESVLDVESDALSKVLPAL
MDWRSRQADESQLAGWRHRIVWKRLTGAALAHRKALSGTWLAVVPEGFADDPWVTTTLDG
LGTHLVHLEVAEADRAALADAIAARTADGTRFGGVISLLALREELTGAVPEGTALTTTLL
QALGDAGVDAPLWCVTRSAVSAGRTDRPHRPLQGAVWGLGRVAALEYPQRWGGLVDLPEE
PDERSAAGLAAVLAGLDGEDQVAVRGTAVLARRLVPAPGRKPSRPWHPSGTVLVTGGTGA
LGAHVARRLAKDGAQHLVLLSRRGPDAPGAAELRAELDALGTDVTVAACDVADRDQLTAV
LDALPADRPLTGVVHTAGVLDDGVLDRLTPERFQEVFRAKVTSALLLDELTRDRELAAFV
LFSSASAAVGNPGQANYAAANAVLDALAEQRRVLGLPATSVSWGAWGGGGMADADGADEA
ARRAGVGAMDPHLAVEALLRLVAEKEPTAVVAEVALDRFAGAFGGSRPSALLREFPGYRE
ALAAQAEQAADGGGLAARLAALPPARRLDTVVDLVRTRAAQVLGYPDTEAVAAERSFRDL
GVDSLGAVELRNQLSAATGLNLPATLVFDHPTPLVLGEHILGGLFPDEPAGSDDETEIRA
LLASVPLDQLREIGVLEPLLQLAGRGGRAADGDDGESVDSMTVADLVRAALNGQSDL
selected fasta
>polyketide synthase [NysI]
ATGGACAACGAACAAAAACTCCGGGATTACCTCAAGCTTGCGACGGCCGACCTTCGACGC
ACCCGGCGGCGCGTCCACAAGCTGGAGTCGGCGGCCCAGGAACCGGTGGCCATCATCGGC
ATGACCTGTCGCTACCCCGGCGGCGTCCGCAGCCCCGAAGACCTCTGGCGCATGGTCGAG
GCCGGCGAGCACGGCGTCACCCCGTTCCCCACCGACCGCGGTTGGGACCTGGAGGCGCTG
GCCGCCGCGCCGACCGCCTCCGGCGGATTCCTGCACGACGCACCCGACTTCGACGCGGAC
TTCTTCGGCATCTCGCCGCGCGAGGCGGTCGCCATGGACCCGCAACAGCGCGTCGTCCTG
GAATCCGCCTGGGAGGCGTTCGAACGCGCCGGCATCGACCCGACGTCCGTGAAGGGCAGC
CGCACCGGAGTCTTCATCGGCGCGATGGCCCAGGACTACCGGGTCGGCCCCGCCGACGGC
GCCGAGGGCTTCCAACTCACCGGCAACACCGGCAGCGTGCTGTCCGGCCGCATCTCCTAC
ACCTTCGGCACGGTCGGCCCCGCCGTCACCGTCGACACCGCCTGCTCCTCCTCCCTCGTC
GCCGTCCACCTCGCCACCCAGGCGCTGCGGGCCGGCGAGTGCACCCTCGCCCTCGCCGGC
GGCGTCACCATCATGTCCGGCCCCGGCACCTTCATCGAAATGGGCCGCCAGGGCGGGCTC
TCCGCCGACGGCCGCTGCCGCTCCTTCGGCGACACCGCCGACGGCACCGGCTGGGCCGAA
GGCGTCGGCATCCTCGTCCTGGAACGGCTGTCCGACGCCGTCCGCAACGGCCACGAGATC
CTCGCCGTCGTCCGCGGCACCGCCGTCAACCAGGACGGCGCCTCCAACGGCCTGACCGCC
CCCAACGGCCCCTCCCAGCAGCAGGTCATCCAGCAGGCCCTGGTCAACGCCCGACTCGCC
GCCGGGGACATCGACGTCGTCGAGGCGCACGGCACCGGCACCACCCTCGGCGACCCCGTC
GAGGCCCAGGCCCTGCTCGCCACCTACGGGCAGAACCGCCCGGCGGACCGGCCGCTGCTG
CTGGGCTCGGTCAAGTCCAACCTCAGCCACACCCAGGCCGCCGCCGGCGTCGCCGGCGTG
ATCAAGATGGTCATGGCGATGCGGCACGGCACCCTGCCGCGCACCCTGCACGCCGAGGAG
CCCACCCACCACGTCGACTGGTCGCAGGGCGCCGTGCGGCTGCTGACCGACACCACCGAC
TGGCCCGCCACCGGGGCGCCGCGCCGCGCCGCCGTCTCCTCCTTCGGCATCAGCGGCACC
AACGCCCACACCATCATCGAGCAGGCCCCCGAACCGCAGCCCGAGGACGCCGCGACCGCG
CAGGACGACGCCGCCGGCAGCACGCCGGCCACCGCCCCCGTAGTGCCCGGCGTCGTACCG
GTCCTGCTCTCCGGCCGCACCCCGGACGCCCTGCGCGGCCAGGCCGCGGCCCTGCGCGCC
GCCCTCGACACCGGCCGGCGGCCCGACCTGCTCGACCTCGCACACTCCCTCGCCACCACC
CGCGCCGGGTTCGAGCACCGCGCCGTCCTCCTCGCCACCGACCACCCCGCCCTGACCGAC
GGCCTCACCGCCCTCGCCGACGCCGACGACCCGGCCGCCGCCCCCGCCTGGATCACCGGC
ACCACCCGGGCCGAGACCCGGCTCGCCGTCCTGTTCACCGGCCAGGGCGCCCAACGCCTC
GGCGCGGGACGGGAACTCGCCGCCCGTTTCCCGGCGTTCGCCACCGCCCTCGACGCGGCG
CTCGACGCCTTCACCCCGCACCTCGACCGCCCCCTGCGCGAGGTCCTGTGGGGCACCGAC
GCCGCCCTGCTCGACCGCACCGCATACGCCCAGCCGGCCCTCTTCGCCGTCGAAGTGGCG
CTCTACCGGCTGATCGAATCGTTCGGCGTCCGCCCCGACCACCTCGCCGGCCACTCCGTC
GGCGAGATCGTCGCCGCGCACCTCGCCGGGGTCCTCTCCCTGGCCGACGCCGCCACCCTC
GTCGCCGCCCGCGGTCGCCTGATGCAGGCGCTGCCCGACGGCGGGGCGATGATCGCCGTC
CAGGCGTCGGAAGCCGACGTCGCCCCGCTGCTCGCCGGGCACGAGGACCAGGTCGCGATC
GCCGCCGTCAACGGCCCCTCCGCCGTCGTCCTGTCCGGCGCCGAAGCCACCGTCACCGCG
CTCGCCGAACAGCTCGCCGCCGACGGCCGCAAGACCCGCCGGCTGCGCGTCTCGCACGCC
TTCCACTCGCCGCTCATGGAGCCGATGCTCGACGCCTTCCGCGCCGTCGTCGAAGACCTC
ACGCTCCAGCCGCCGCTCCTGCCGGTCGTCTCCAACCTGACCGGCAAGCCCGCCACCGTC
GCCCAACTCACCTCCGCCGACTACTGGGTCGACCACGTCCGGCACGCCGTCCGCTTCGCC
GACGGCATCGACTGGCTCGCCCGGCACGACACCACCGCCTTCCTCGAACTCGGCCCCGAC
GGCGTGCTGTCCGCCATGGCCCAGGACTGCCTGGACGCCGCCGACGCAGACGCCGTCACC
CTCCCCGCCCTGCGCGCCGGGCGCCCCGAGGAGCACACCCTCACCACCGCCCTCGCCGGT
CTGCACGTCCACGGCGCCACCCTGGACTGGACCGGCTGCTTCGCCGGCACCGGCGCCCGC
CGCACCGACCTGCCGACCTACGCCTTCCAGCGCCGCCGCTACTGGCCCAAGGCCCTCCAG
AGCGGCACCGCCGACCTGCGCTCGGTCGGCCTCGGTGCCGCCCACCACCCGCTGCTCTCC
GCCGCCGTCTCCCTCGCCGACGCAGGCGGCACCCTGCTCACCGGCCGCCTCTCCCGGCAG
ACCCACCCCTGGCTCGCCGACCACACCGTCCGCGGCACCACCCTGCTGCCCGGTACCGCC
TTCCTCGAACTCGCCGTCCGCGCCGGCGACGAGGTCGGCTGCGACCGCGTCGAGGAACTC
ACCCTCGCCGCACCGCTCCTGCTGCCCGAACAGGGCGGCGTCCAGGTCCAGTTGTGGATC
GGCAACCCCGACGTGTCCGGTCGCCGCACCGTCAACGTCCACGCCCGCCCCGACACCGGC
GACGACACCCCCTGGACCGCCCACGCCACCGGCGTCCTCACCACCGCCGACGCCTCCCGC
CAGCTCCCGGCTTCGTCCGAGCAGGGCGGCACCCCCCTCGCCGGCGACCCCCACCCCGCC
CTCGACGCGGCCCAGTGGCCCCCGGCCGGCGCCGAACCGCTGCCGCTGGACGGCCACTAC
GACCGCCTCGCCGACGGCGGCTTCGGCTACGGCCCGGTCTTCCAGGGCCTGCGCGCCGCC
TGGCGCGGCGGCGACGTCGTCTACGCCGAGGTCGAGCTGCCCGAGGCCGGCCGGTCCGAC
GCCGAGGCGTTCGGCCTCCACCCCGCCCTGCTCGACGCCGCCCTGCACGCCGCGCCCTTC
ACCGGCCTCGGCGAACGCGGCCGGGGCGGCCTGCCGTTCTCCTGGGAGGGCGTCTCCCTC
CACGCCGGCGGCGCCACCACCCTCCGCGTCCGCCTGACCCCGGTCGCCGACGACGCGCTC
GCCCTGACCGTCGCCGACGGCACCGGCGCGCCCGTGCTGTCCGTCGACTCGCTCGTCCTG
CGCAGCGTGGCGACCCAACAGCTCGACACGGCCGCCGCCGTCGCCCGTGACGCCCTCTTC
CGCCTCGACTGGACCCCCGTCCAGCCGACCGCCACCGACCCCGGGCCCGTCGCCCTCCTC
GGCGCCGACCCCTTCGGCCTGCTCACCCACGCCGGATTCGCCGACGCCCCGGCATACCCG
GACCTCGCCGCCCTCGCCGCGGCGGACGGCCCGGTCCCGACCACCGTCGTGCTGTCCCTC
GCCGGCACCGGGGACGACGCGGCCGACCCGGCCCGGTCCGCACACCGCTGCGCCGCGGAG
GCCCTCGCCGCCGTACAGACCTGGCTCGACCACCATGAGCGCTTCGCCGCCGCCCGCCTG
GTCTTCGTGACCCGTGGTGCGACGGTCGGGCGTGATGTTGCTGCTGCTGCGGTGTGGGGT
CTGGTGCGTTCGGCGCAGTCGGAGAATCCGGGGTGTTTTGCTCTGGTCGATCTGGATCCG
GATGGTGCGGTGGGTGCGGCTGCGCTCGTCGCTGCGTTGGTCAGTGGTGAGCCGCAGCTT
GCGGTGCGCGGTGATGTGTTGCGGGTCGCGCGTCTGGTGCGGCGGCCGCTCACCGAGGTC
GGTGCGGGTGCTGATGGCACCGGGGATGGCGTCGGGGATGGCTCTGGTGTGTCGTTCTCG
GGTGAGGGTGCGGTCCTGGTCACTGGTGGTACGGGTGGTCTGGGTGCGGTGTTGGCGCGT
CATCTGGTGGCCGAGTATGGGGTGCGGGATCTGCTGTTGGTCAGTCGCAGTGGTGAACGT
GCCGTGGGTGCTGGGGAGTTGGTGGCGGAGCTTGCGGGTGTGGGTGCGCGGGTGCGGGTG
GTTGCGTGTGATGTGACCGATCGTGCCGCGGTGGTGGAGTTGGTTGGCGGGCATGCGGTG
TCCGCGGTGGTTCATGCGGCTGGTGTGCTGGATGACGGCATGGTGGGTGCGTTGACCGGG
GAGCGGTTGTCCGCGGTGCTGCGGCCGAAGGTGGATGCTGTCTGGCATCTACATGAGGCG
ACCCGCGGCCTGGACCTGGACGCGTTCGTCGTCTTCTCCTCCCTCGCCGGGGTCTTCGGC
AGTCCCGGCCAGGCCAACTACGCGGCCGCGAACGCCTTCCTGGACGCGCTGATGACGCGG
CGCCGGGCGGAGGGACTGCCCGGCCTGTCACTCGCATGGGGACCGTGGGAGCAGTCGGGC
GGAATGACGGGCACCCTGACGGACGTCGACGCCGAACGGCTGGCCCGCTCCGGTGTCCCG
CCGCTCTCCGTGGCGCAGGGCCTGGCCCTCTTCGACGCTGCCGTGGCCGGGACCGACGCC
ACCTGCGTTCCGGTCCGCCTGGACCTCCCCGTCCTCCGCGCACGGGGTGAAGTGCCGCCG
CTGCTGAGGTCGTTGATCCGCGTCCGGGCGCGCCGAGCCGCCGTCGCCGGCTCCGCCACC
GCGGGCAACCTCGCCCAGCGCCTGCGCCGCCTGGACGAGGACGGCCGCGACGAGATGGTC
CTGGACCTCGTCCGCGGTCAGGTCGCCCTCGTCCTCGGCCACGCGACCGGTGGCGACGTC
GACGCCGGCCGTGCCTTCCGCGACCTCGGCTTCGACTCGCTGACCGCCGTCGAACTGCGC
AACCGCCTCAACACCGTCACCGGCCTGCGCCTGCCCGCCACCCTGGTCTTCGACTACCCG
ACCGTCCGGCACCTCGCCACGTACGTCCTGGACGAGTTGTTGGGCACGGATGCCGAGGTG
GCGACCGTGCAGCCGGCCGCGGTTGCGGTGGCGGACGATCCGATCGTCATCGTGGGCATG
GCCTGCCGCTACCCCGGTGGCGTCAGCTCCCCCGAGGACCTGTGGCGCGTGCTCACCGAA
GGCACCGACGCCGTCTCGGGCTTCCCGACCAACCGTGGTTGGGACGTCGAATCCCTCTAT
CACCCGGACCCTGACCACCCGGGTACCTCCTACACGCGCTCGGGTGGGTTCCTGCATGAG
GCGGGGGAGTTCGATCCGGGGTTCTTCGGGATGAGTCCGCGGGAGGCGTTGGCGACCGAT
TCCCAGCAGCGGTTGTTGTTGGAGTCGTCGTGGGAGGCGATCGAGCGGGCCGGTATTGAT
CCGGTGAGTTTGCGGGGTAGTCGGACGGGTGTGTTCGCGGGGGTGATGTACAGCGATTAC
AGCGCGATGTTGGCGAGTCCGGAGTTCGAGGGTTTCCAGGGCAGTGGGAGTTCGCCGAGT
TTGGCGTCGGGTCGGGTGGCCTACACGTTGGGGTTGGAAGGCCCGGCGGTGACGGTGGAT
ACGGCGTGTTCGTCGTCGTTGGTGGCGATGCACTGGGCGATGCAGGCGTTGCGTAGTGGT
GAGTGTGGGTTGGCGTTGGCCGGTGGTGTGACGGTGATGTCGACGCCTGCGGTGTTTGTG
GACTTTGCTCGGCAGCGGGGTTTGTCGCCGGATGGCCGGTGCAAGGCGTTTGCGGATGCG
GCCGATGGTGTGGGCTGGTCCGAGGGCGTCGGCGTGTTGGTCCTGGAGCGGCAGTCGGAC
GCGGTGCGCAATGGTCACGAGATTTTGGCTGTGGTGCGGGGTTCGGCGGTCAACCAGGAT
GGTGCGTCCAATGGTTTGACGGCGCCCAATGGTCCGTCGCAGCAGCGGGTGATCCGGCAG
GCGTTGGCCAGTGGTGGTCTGACGGCCGGTGACGTGGATGTGGTGGAGGCGCATGGTACG
GGTACGACGCTCGGTGATCCGATCGAGGCGCAGGCGTTGTTGGCGACGTATGGGCGGGAT
CGTGAGCCTGAGCGGCCGTTGTTGTTGGGTTCGGTGAAGTCGAATCTGGGGCATACGCAG
GCTGCTGCGGGTGTGGCGGGCGTTATCAAGATGGTGTTGGCGATGCGGCATGGTGTGGTG
CCGCGGACGTTGCATGTGGATGCGCCTTCTTCGCATGTGGACTGGTCCGAGGGTGCGGTG
GAGCTGCTCAGTGAGCAGGCGGCCTGGCCGGAGACGGGTCGGGTGCGGCGGGCGGGTGTC
TCCTCCTTCGGCATCAGCGGTACCAATGTGCATGTCATCGTCGAGCAGGCGCCGGGCGCC
AAGGCGATCGCCGCGGCCGGTGCGGCGCGGCGCACGCCGGGTGCCGTGCCGGTGCTGCTC
TCGGGGCGTGGCCGGAGTGCCCTGCGGGGCCAGGCCGCCCGCCTGCTCGGACACCTCCAG
GCCCGACCCGACGCCGAACTCGTCGATGTCGCACTGTCGTTGGCGACCACCCGGTCCCGC
TTCGAGCAGCGGGCCGCCGTCGTGGCGCAGGACCGCGACCAGCTGATCGCCTCGCTGGGG
GCGCTGGCCGCCGACCGCCCCGACCCCGCCGTCGTCGAGGGCGAGGCCGCCGGACGCGGC
CGGACCGCGGTGCTGTTCACCGGACAGGGCAGCCAGCGGGCCGCCATGGGGCGTGAACTC
CACGAGGTGCAGCCGGAGTTCGCCGCGGCGTTCGACGCGGTGTGTGCCGTTTTCGACCCG
CTGTTGGACCGGCCGCTGCGCGAGGTGGTGTTCGCCGAGGACGGCAGCGACGAGGCCGCA
CTGCTGGACGAGACCGGTTGGACGCAGCCGGCTCTGTTCGCCGTCGAGGTGGCGCTGTTC
CGGCTGGTGGAGAGTTGGGGTGTCCGTCCGGACTTCGTGGCCGGCCATTCCATCGGTGAG
ATCGCGGCGGCGCACGTCGCCGGGGTGCTGACGTTGGAGGACGCCTGCCGTCTGGTGGCC
GCGCGGGCGACGCTGATGCAGGCGCTGCCGACCGGCGGCGCGATGATCGCGATCCAGGCC
ACCGAGGACGAGATCGCGGCGCACCTCGACGACACGGTGGCGATCGCCGCCGTCAACGGG
CCGCAGTCCGTGGTGATCTCCGGTGACGAGGAGGCCGCCGAAACGATCGCCGCCACGTTC
GCCGAACGCGGGCGCAAGACCAAGCGGCTGCGGGTGAGCCATGCCTTCCACTCGCCGCGG
ATGGACGGGATGCTGGACGCCTTCCGGATCGTCGCCGAGGGGCTGACCTACCGGGCGCCG
CGCATCCCGCTCGTCTCCGACCTCACCGGCCGGCGCGCCGACGATGCGGAGGTGTGCACC
GCGGAGTACTGGGTGCGGCACGTCCGAGAGGCCGTGCGGTTCGCCGACTGCGTGCGGACG
CTGCGCGACGCCGGGGCCACCACCTTCCTGGAACTGGGCTCCGACGGCCTGCTGACCGCG
ATGGCCGAGGACACCCTCGGTGACGACCACGACGCCGAACTGGTGCCGATGCTGCGCGCC
GGGCGCGCCGAGGAACTGGCCGCGGCCACCGCCCTGGCCCGCCTCCAGGTGCGCGGCGTG
GACGTGGACTGGGCGGCGTACCTCGCCGGCACCGGCGCCCGACGCACCGACCTGCCGACC
TACGCCTTCCAGCACGCGTACTACTGGCCGCAGCTGCCGACCCCGGCCGCCGCCCTCGCC
GCCGCCGATCCCGCCGACCAGCAGCTGTGGGCCGCTGTGGAGCGCGGCGACGCCCGCGAA
CTCGCCGACATCCTCGGCCTGGGCGAACAGGACCTCACGCCGCTGGACTCCCTGCTGCCC
GCCCTCACCTCGTGGCGGCGCGGCAACCAGGAGAAGCACCTCCTGGACACCCTGCGCTAC
CGCGTGGAGTGGACACGACTGAGCAAGCCGACCGCCCCGGTCCTCGACGGCACCTGGCTG
CTGGTCGCCTCCGACGCCACCGCGGCCGACCAGCCAGCCCTCCTCGACGGCCTGGCCGAC
GCCCTCGGCTCGCACGGCGCGCGGGTGCGTCGCCTGCTTCTGGACGACTCCTGCGCGGAC
CGCGCGGTGCTCGCCGAACGACTGGCGCGGACCGCCGACGTGGACGCCGCGACCCAGGTG
CTGTCCGTGCTGCCGCTCGACGAGCGGGACGCCGACGACTGCCCGCCGCTCACCCGCGGA
CTGGCGCTGACCGTCGCGCTCGTCCAGGCCCTCGCCGACACCGGCGCCCAGGGCCGGCTG
TGGACCGCCACCCGCGGCGCCGTCTCCACCAACCCCGCCGACCCGGTCACCCACCCCGTC
CAGGCCGCTGCCTGGGGCCTGGGCCGGGGCGTCGCCCTGGAGCACCCACGGCTGTGGGGC
GGCCTGGTCGACCTGCCGCAGGTCTTCGACGAGCGGGCCGGACAGCGGCTCGCCGGGATC
CTCGCCGTCAAGGACGCACCGGACGGCGAGGACCAGGTGGCGCTGCGGGCCACCGGAGTC
TCCGGCCGCCGGCTCGTCCGCCACACCGTCGAAGCGCTGCCCACGGCCGCGGAGTTCACC
GCCACCGGCACTGTCCTGATCACTGGTGGCACCGGTGGCCTGGGCGCCGAGGTCGCCCGG
TGGCTGGCCCGCGCCGGCGCCCAGCACCTCGTCCTGACCAGCCGCCGCGGCCCGGACGCG
CCGGGCGCCGCCGAACTCCGGGCCGAACTGGAGGGCTACGGGCCGTCGGTGTCCGTCGTC
GCCTGCGACGTCGCCGACCGGGACGCGCTCGCCGCCGTCCTCACCGCACTGCCCGAGGAA
CTGCCGCTGACCGGTGTCGTGCACACCGCAGGCGTCGGCCACTACGGCCCGCTGGACACC
CTGAGCACCGCCGAGTTCGCCGGCCTCACCGCCGCCAAGCTCGCCGGCGCCGCCCACCTC
GACGCCCTGCTCGCCGACCGCGAACTGGACTTCTTCGTCCTCTTCGGCTCCATCGCCGGT
GTCTGGGGCAGTGGCAACCAGAGCGCCTACGGCGCCGCCAACGCCTACCTCGACGCGCTC
GCCCTGCACCGCCGCGCCCGCGGCCTCGCCGCGACCTCCGTCGCCTGGGGCCCGTGGGCC
GAGGCCGGCATGGCCGCCGACGATGCCGTTTCCGAGACCCTGCGCCGCCAGGGCCTCGGC
CTGCTCGACCCGGCCCCGGCCATGACCGAGCTGCGCCGCGCCGTCGTCCGGCAGGACGTC
ACCGTCACCGTCGCCGACGTGGACTGGCAGCGCTACGCACCGCTGTTCACCTCCGCCCGG
CCCAGCGCCCTGATCGCCGGCCTGCCCGAGGTCCGCGCCCTCGCCGCCGACGAGCGCACC
GAGCAGGACGCCACCGGCGCCTCCGAGGTCGTCACCCGCGTCCGCGCCCTGGCCGAACCC
GAGCAACTGCGCCTGCTGACCGACCTCGTCCGCACCGAGTCCGCCACCGTCCTCGGCCAC
AGCTCCGCCGACGCCGTGCCCGAGGGCCGCGCCTTCCGCGACGTCGGCTTCGACTCGCTG
ACCGCGGTCGAGCTCCGCAAGCGCCTGGGCGCCGCGACCGGGCTGTCCCTGCCCAGCACC
ATGGTCTTCGACTACCCGACACCGCTGGAACTCGCCCAGTACCTGCGGGCGGAGATCCTC
GGCGCGGTGCTGGAAGTCGCCGGCCCGGTCGCCACCGGCGGCGCCGACGACGAGCCGATC
GCCATCATCGGCATGGCCTGCCGCTTCCCCGGCGGCGTCAGCTCCCCGGAACAGCTGTGG
GACCTGGTCGCCTCCGGCACCGACGCGATCAGCGAGTTCCCCGTCAACCGCGGCTGGCAG
ACCGGGCACCTCTTCGACCCGGACCCCGACCGGCCCGGCACCACCTACTCCACCCAGGGC
GGCTTCCTCCACGAGGCCGACGAGTTCGACCCCACCTTCTTCGGCATCTCGCCCCGCGAG
GCGCTGGTCATGGACCCGCAGCAGCGGCTCCTGCTGGAGACCACCTGGGAGTCCTTCGAG
CGCGCCGGGATCCGCCCGGAAACCCTCCGATCCACCCTGACCGGCACCTTCGTCGGCTCC
AGCTACCAGGAGTACGGCCTGGGCGCGGGCGACGGCACCGAGGGCCACATGGTCACCGGC
AGCAGCCCCAGTGTGCTCTCCGGCCGACTGTCGTACGTCTTCGGTCTGGAAGGCCCGGCG
GTCACCGTCGACACCGCCTGCTCGTCCTCGCTCGTGGCGCTGCACCTGGCCTGCCAGTCG
CTGCGCAACGGCGAGAGCAACCTGGCCGTCGCCGGCGGCGCCACGATCATGACGACGCCC
AACCCGTTCATCGCGTTCAGCCGGCAGCGCGCCCTCGCCAAGGACGGCCGCTGCAAGGCG
TTCTCCGACGACGCGGACGGCATGACGCTCGCCGAGGGCGTCGGCGTCGTCCTCGTCGAG
CGGCTCTCCGACGCGCAGCGCAACGGCCACCCGGTCCTGGCCGTCCTCCGCGGCTCCGCC
ATCAACCAGGACGGCGCCTCCAACGGCCTGACCGCGCCCAACGGCCCGTCCCAGCAGAGG
GTCATCCGCCAGGCCCTCGCCAACGCCCGCCTCGCGCCCGGGGACATCGACGCCCTGGAG
GCGCACGGCACCGGCACACCGCTCGGCGACCCCATCGAGGCCCAGGCACTGTTCGCCACC
TACGGCCGCGACCGCGACCCCGAGAGCGCGCTGCTGCTCGGCTCGGTGAAGTCCAACATC
GGCCACACCCAGTCCGCCGCGGGCATCGCCAGCGTCATCAAGATGGTCATGGCGCTGCGC
CACTCCGAACTGCCGCCGACCCTGCACGCCGACGCGCCGTCCTCGCACGTGGACTGGTCG
GCCGGGACGGTCCGGCTGCTGACCCAGGCGCGCGCCTGGCCGGAGACCGGTCGCCCGCGC
CGGGCCGCGGTGTCCTCGTTCGGCATCAGCGGTACCAACGCCCATGTCCTGCTGGAGCAG
GCGCCCGTCGCGGACACCCCGGCCGAGGAGCGGCCCGCCGTGGCGCCGGTCCCGATCGCC
GCCGGCGTCGTCCCGTGGGTGGTCACCGCCCGCAGCGCCGCCGCCCTGCGCGGCCAGGCC
GAGCGCCTCCTCGCGCACGCCGAAACCGTCGGAACCGCCCTGCCGGCCGCCGGACCGCTC
GACATCGGCCTGTCGCTGGTCTCCGCGCGCGCCCGTTTCGAGCACCGTGCCGTCGTCGTC
CCGCCCGCGGGCACCGACCCGCTGGCCGCGCTGCGCGCCGTCGCGACGGACGGGCCCTCG
CCCGTGGTCGCCCGTGGCGTGGCGGACGTCGAGGGTCGGACGGTGTTCGTGTTCCCCGGT
CAGGGTTCGCAGTGGGTGGGGATGGGGTCCCAACTCCTTGATGAGTCGGCGGTGTTCGCG
GAGCGGATTGCCGAGTGTGCGGCGGCACTCGCCGAGTTCACCGACTGGTCGCTGGTCGAT
GTGCTGCGGGGTGTGGTGGGTGCGCCGTCGTTGGAGCGGGTCGATGTGGTGCAGCCGGCG
TCGTTCGCGGTGATGGTGTCGTTGGCTGCGTTGTGGCGTTCCCGTGGTGTGTTGCCGGAT
GCGGTGGTGGGGCATTCGCAGGGTGAGATCGCTGCTGCGGTGGTGTCGGGTGCGCTGTCG
TTGCGGGACGGGGCGCGGGTGGTGGCGCTGCGGAGTCAGGCCATTGGTCGTGCGTTGGCG
GGGCGGGGAGGGATGATGTCCGTCGCGCTGTCGGTGGACGTGCTCGAACCGCGGTTGGTC
GAGTTCGAGGGGCGGGTGTCGGTGGCCGCCGTCAACGGCCCGCGCTCCGTCGTGGTCGCC
GGCGAGCCCGAGGCGCTGGACGCGCTGCACGCCCGGCTGACCGCCGACGACATCCGGGCC
CGCCGGATCGCGGTGGACTACGCCTCGCACTCGCACCAGGTCGAGGACCTGCACGAGGAA
CTGCTGGAGGTGCTGGCGGAGCTGGCGCCGCGCACGTCGGAGGTGCCGTTCTTCTCGACC
GTGACCGGCGACTGGCTGGACACCGCGCGGATGGACGCCGGCTACTGGTTCCGCAACCTG
CGCGGACGGGTGCGGTTCGCGGACGCGGTGGCGGACCTGCTGGCGGCGGAGTACCGCGCA
TTCGTCGAGGTCAGCTCGCACCCGGTGCTGTCGATGGCGGTGCAGGAGGCGATCGACGAG
GCCGGCGTGCCGGCCGTCGCCGCCGGCACCCTGCGCCGCGACCAGGGCGGCACCGACCGC
TTCCTGCTGTCGGCCGCCGAGGTCTTCGTGCGCGGTGTGGACGTGGACTGGGCGGGGCTG
TTCGAGGGGACCGGTGCGTCCCGGATCGACCTGCCCACCTACGCCTTCCAACACGAACAC
CTGTGGGCCGTCCCGCCCGCCCCGGAGGCCGTCGCCGCCGCCGACCCGGACGACGCGGCC
TTCTGGACCGCGGTCGAGGACGGTGACGTCTCCGCGCTGACCGCCGCGCTCGGCACCGAC
GAGGACTCCGTCGCCGCCGTGCTGCCCGCCCTGACCTCCTGGCGCCGGGCCCGCCGCGAC
CGCTCCACCGTGGACGCCTGGCGCTACCGCGTCGCCTGGAAACCCCTCGGCGGCACCCTG
CCGCACCCGTCCCTGACCGGCACCTGGCTGCTGGTCACCGCCGACGGCATCGACGACACC
GATGTGGCAGGGGCGTTGGAGACCTACGGCGCCGAGGTGCGCCGGCTGGTCCTGGACGAG
GAGTGCGTCGACCGCGCCGTCCTGCGGGAGCGGCTGGCCGGCGCGGAGGACGTGACCGGC
ATCGTCTCCGTCCTCGCCGCCGCCGAGCGGACCGACGCGGTACCGGGCACCTCCCTGGTG
CTCGGCACCGCCCTGACCGTGGCACTGATCCAGGCCCTCGGCGACGCCGAAATCGACGCT
CCCGTATGGGCGTTGACCCGCGGCGCGGTCTCCACCGGCCGGGCCGACGAGCTGACCGCG
CCCGTCCAGGCACAGGTCACCGGCATCGGCTGGACCGCGGCGCTGGAGCACCCGCAGCGC
TGGGGCGGCACCCTCGACCTGCCCGCCGCCCTCGACGCCCGGGCCGCCCAGCGGCTCGCC
GCCGTGCTGTCCGGCGCCCTCGGCAGCGACGACCAGCTGGCCATCCGGCCCTCCGGGGTC
TTCACCCGCCGCATCGTGCGGGCCGAGGCCACCGCCGGGCGGCCCGCCGGCACCTGGACG
CCGCGCGGCACCACACTGGTCACCGGCGGCTCCGGCACCCTCGCCCCGCACCTCGCCCGC
TGGCTGGCCCAACGCGGCGCCGAGCACCTGGTCCTGATCAGCCGGCGCGGCACGGCCGCC
CCGGGCGCCGCCGAACTCGTCGCGGAACTGGCCGAGTCGGGCACCGAGGCGACCGTCGCC
GCCTGCGACATCACCGACCGCGACGCGGTCGCCGCGCTGCTGGCCGACCTCAAGGCCGAC
GGGCGCACCGTCCGCACCGTCGTGCACACCGCCGCCACCATCGAGCTGCACACCCTGGAC
GCCACCACCCTGGCGGACTTCGACCGGGTGCTGCACGCCAAGGTCACCGGCGCCCAGGTC
CTCGCCGAACTGCTCGACGACGAAGAGCTGGACGACTTCGTCCTGTACTCCTCCACCGCC
GGCATGTGGGGCAGCGGCGCCCACGCCGCCTACGTCGCCGGCAACGCCTACCTCGCCGCG
CTCGCCGAGCACCGCCGGGCCAACGGACTGCCCGCCCTGTCGCTGTCCTGGGGCATCTGG
GCCGACGACCTCAAACTGGGCCGGGTCGATCCCCAGATGATCCGGCGCAGCGGCCTGGAG
TTCATGGACCCGCAGCTGGCCCTGAGCGGCCTGCAGCGGGCGCTGGACGACAACGAGAAC
GTGCTCGCGGTCGCCGACGTGGACTGGGAGACCTACCACCCCGTCTACACCTCCGGCCGA
CCCACCCCGCTCTTCGACGAGGTGCCGGAGGTCCGCCGGCTCACCGCGGCCGCCGAGCAG
AGCGCCGGGACCGTCGCCGAGGGCGAGTTCGCCGCCGCGCTGCGCGCCCTGTCCGACGCC
GAGCAGCAGCGCACCCTGCTGGAGACCGTCCGCACCGAGGCGGCGTCCGTCCTCGGGCTG
TCCTCCGCCGAGGACCTCACCGACCAGCGGGCCTTCCGCGACGTCGGCTTCGACTCGCTG
ACCGCCGTCGGCCTGCGCAACCGGCTCGCCTCCGTCACCGGCCTGACGCTGCCCTCGACG
ATGGTCTTCGACTACCCCAACCCGGCCGCGCTCGCCGCCTATCTGCACGGCGAGCTGGCC
GGCGCCCGGTCCGCCGCCGCCGGCGCCGCCGCCGTCCCGACCGGCGCCCCCGACGCCGAC
GACCCGATCGCGATCGTCGGCATGAGCTGCCGCTACCCCGGCGGGGTCGGCTCCGCCGAG
GACCTGTGGCGGATCGCCCTGGACGAGGTCGACGCGATCTCCGGCTTCCCCGCCGACCGC
GGCTGGGACGCCGAGGGCCTCTACGACCCGGACCCCGACCGGCCCGGCCGCACCTACTCC
GTCCAGGGCGGATTCCTGCGCGACGTCGCCGAGTTCGACCCGGGCTTCTTCGGGATCTCG
CCGCGCGAGGCGCTGTCGATGGACCCGCAGCAGCGGCTCCTGCTGGAGACCGCCTGGGAG
GCGTTCGAGCACGCCGGCATCGACCCGGTCGGCCAGCGCGGCAGCCGCACCGGCACCTTC
GTCGGCGCCAGCTACCAGGACTACGCCTCCGGCGTGCCCAACAGCGAGGGCTCCGAAGGC
CACATGATCACCGGCACGCTCTCCAGTGTGCTGTCCGGCCGGGTGTCCTACCTCTTCGGC
TTCGAGGGCCCCGCCGTCACGCTCGACACCGCCTGCTCCTCCTCCCTGGTCGCCATGCAC
CTGGCCTGCCAGTCCCTGCGCAACGGGGAGAGCTCGCTGGCCCTGGCCGGCGGCGTCAGC
ATCATGTCCACCCCGATGTCGTTCGTCGGCTTCAGCCGGCAGCGCGCCCTCGCCGAGGAC
GGCCGCTGCAAGGCGTACGCGGACGGCGCCGACGGGATGACCCTCGCCGAGGGCGTCGGC
CTGGTGCTGCTGGAGCGGCTGTCCGACGCCCGCGCCAACGGGCACCAGGTGCTCGCCGTG
ATCCGCGGCTCCGCCGTCAACCAGGACGGCGCCTCCAACGGCCTGACCGCACCCAACGGC
CCGTCCCAGCAGCGCGTCATCCGCCAGGCGCTGGCCAACTCCGCGGTGGCGCCCGGCGAC
ATCGACGTCCTGGAGGGCCACGGCACCGGTACCGCCCTCGGCGACCCCATCGAGGCGCAG
GCCCTGCTCGCCACCTACGGCCAGGACCGCGCCCCCGAACGGCCGCTGCTGCTCGGCTCG
GTGAAGTCCAACATCGGCCACACCCAGATGGCATCCGGCGTCGCCAGCGTCATCAAGCTC
GTCCGCGCCCTCCAGGAAGGCGTGGTGCCCAAGTCCCTGCACATCGACCGGCCCTCCACC
CACGTCGACTGGTCCTCGGGCGCCATCGGGCTGCTCACCGAACGCACCCCGTGGCCCGAG
ACCGGCCGGCCGCGCCGCGCCGCCGTCTCCTCCTTCGGCATCAGCGGCACCAACGTCCAC
ACCATCCTCGAACAGGCCCCCGCGGACGAGGCGCCCACGCCCGCCGACCCGCCGCGGGAC
GGCCTGGTGCCGGTCCTGCTCTCCGGCCGCGGCGAGGCCGCGCTGCGCGCCCAGGCCGCC
CGCCTGCTCGCCTTCGTCGAGGAGCGGCCCGAGGCCCACCTCACCGACCTCGCCCACTCC
CTCGCCACCTCGCGCGCCGCGCTGGAACGCCGCGCCGCCGTCATCGCCGCCGACCGCGAC
ACCCTGACCCGCGGCCTGCGCGCCCTGTCCGACGGCCGGCCCGACCCCGGCCTGGTCCAG
GGCACCGCGGGACGCGGCCGGACCGCCTTCCTGTTCACCGGACAGGGCAGCCAGCGCCCC
GGCATGGGCCGCGAACTCCACGACCGCTACCCGGTGTTCGCCGACGCGCTGGACGAGGTG
CTGGCCCGGCTCGACGACGGACCGGACCGGCCGCTGCGCGAGGTGCTGTTCGCCGCGCCC
GACTCCGCCGAGGCCGCGCTCCTGGACCGGACCGGCTACGCCCAGCCCGCGCTGTTCGCC
GTCGAGGTCGCGCTGTTCCGCCTGCTGACGTCCTGGGGCCTGACCCCGGACTACCTGGCC
GGCCACTCCGTCGGCGAACTCGCCGCCGCGCACGTCGCCGGCGTGCTGTCGCTGGACGAC
GCCTGCACTCTGGTCGCCGCCCGCGGCCGGCTCATGCAGGCGCTGCCCGAGGGCGGCGCG
ATGGTCGCCCTGGAGGCCGCGGAGGACGAGGTCCTGCCGCTCCTGGAGGGGCTCACCGAC
CGGGTGTCCGTCGCCGCCGTCAACGGGCCGCGGTCCGTGGTCGTCGCCGGCGTCGAGGAG
GACGTGCTCCTCCTCGCCGACCTCTTCGCCGCCGACGGGCGCCGGACCAAGCGGCTGCGG
GTGAGCCATGCCTTCCACTCGCCGCTGATGGACGCCATGCTCGACGACTTCGCCGCCGTC
GCCCGCGGGCTGACCTACCACCCGCCGACGATCCCGTTCGTGTCGAACGTCAGCGGCGGC
CTGGCCACCGCCGAACAGGTCCGCACGCCCGACTACTGGGTCGGGCACGTCCGCGCCGCG
GTCCGCTTCGCCGACGGCATCGACTGGCTCGCCACCCAGGGCGACGTCCACACCTTCCTG
GAGCTCGGCCCGGACGGCGTGCTCAGCGCCATGGCCCGGGAGAGCCTCACCGACCCGTCC
CGCACGGCACTGCTGCCGACCCTGCGCGGCGACCGGCCCGAGGAACCTGCCCTGGTCACC
GCGGTCGCCGCGGCCCACGCGCACGGCGCCCGCGTCGACTGGAGCGGGTACTTCGCCGAC
CACGGCGCGCGCCGGACCACGCTGCCGACCTACGCGTTCCAACGCGAGCGGTACTGGCCC
GACACCACCGCCGCCACGAGCGCCCACACGCCCGGATCCGCCCTCGACGCCGAGTTCTGG
GCCGCCGTCGAGCGGGACGACGTCGCCGCCCTCGCCGCCTCCCTGGACCTGGACGACGCC
ACCGTCACCGCGATGGTCCCCGCGCTCACCGCCTGGCGCCGGCGCCGCGGCGAGCAGACC
GAACTGGACTCCTGGCGCTACCGCGTCACCTGGAAGCCGCGCGGCGGCGCCACCGCACCC
GCCGCCCTCACCGGCCGCTGGCTCGTGCTCGTCCCGCACGACCACCAGGACCGTCAGGAC
GACGCGACCGCGGCCTGGGCAGCCGACGTCGAGACCGCCCTGGGCACCACCACCGTCCGG
CTGACGGTCACCACCACCGACCGCGCCGCGCTGGCCGCCCGGATCACCGAAGCCGCCGGC
GACCAGGGCCCGTTCAGCGGTGTGCTGTCCCTGCTGCCGCTCGCCACCGGCGACGCCGGC
CACCCCGGTGCGCCCGCCGCCCTCACCCTCACCACCACCGCCGTCCAGGCCCTCGGCGAC
GCCGGCATCGACGCGCCGCTGTGGAACGTCACCCGCGGGGCCGTGGCCGTCGGCCGCGCC
GAACAGGTCACCGCGCCCGAACAGGCCGCCGTCTGGGGCCTGGGCCGCGCCGTCGCCCTG
GAACTGCCGGCCCGGTTCGGCGGCACCCTCGACCTGCCCGCCACCCTGGACGGCCAGGCC
GCCCGCCGGTTGCGCGCGGTGCTCGCGGCTACCGACGGCGAGGACGCGGTGGCCCTGCGG
CCCTCCGGCGTCTTCCTCCGCCGCCTGGCCCACGCCCCGGCCGGCCCCGACACCGCCCGC
ACCGCCTTCGACCCGGCGGCCGGCACCGTCCTGATCACCGGCGGCACCGGCGGCATCGGC
GGCCACGTCGCCCGCCGCCTGGCCCGCGACGGCGCCACCCACCTGCTGCTCACCAGCCGC
CGCGGCCCGGCCGCCCCCGGCGCCGACGCGCTCCGCGCCGAACTGGAGGAACTGGGCGCC
CGGGTCACCCTCGCCGCCTGCGACGCCGCCGACCGCGACGCGCTGGCCGCGCTCCTCGCC
GAACTGCCCGACGACGCCCCGCTGTGCGCGGTGTTCCACACCGCCGGCGTCGTCGAGGAC
CACGTCGTGGACGCGCTCACACCGGAGAACTTCGCCGCGGTGCTGCGCGCCAAGACCGTC
GCCGCCCACCACCTGCACGAGCTGACCGCCGACCTGGACCTCGCCGCTTTCGTGCTGTTC
TCCTCCACGGCCGGCGTCCTCGGCGCCGCCGGACAGGGCAACTACGCCGCGGCCAACGCC
CACCTGGACGCCCTCGCCGAACACCGCCGCTCCCACGGCCTGACCGCGCTGTCCGTCGCC
TGGGGCCCGTGGGCCGGCTCCGGCATGGTCGCCGACGCCGCCGAACTCACCGACCGGGTA
CGGCGCGGCGGCTTCGAACCGCTCGCCCCCGAACCGGCCGTGCGCGCCCTGCTGCGCGCC
ATCGAGAACGACGACACCACCGTCGCGCTCGCCGACATCGACTGGGAGCGCTTCCAGCGC
GCCTTCGCCGCGGTCCGCCCGCTGCCGTTCGTCGCCGACCTCCCCGAGACCGGCCGGGCC
ACCCCCGCGACCGCCACCGGCGCCGCCACCGGCCTGCGGCAGCAACTCGCCGAACTGCCG
GAGCACGAGCGCCCGGCAGCGGTCCTGGACCTGCTGCGTACCCAGGTCGCCGCCGTCCTC
GGCCACGCCGACCCGCGCACCGTCGAGGACGACCACGCCTTCCGCGACCTGGGCTTCGAC
TCGCTGACCATCCTGGAACTGCGCAACGCCCTCAACGCCGCCACCGGCCTGAGCCTGCCC
GCCACCCTGGTCTACGACCTGCCCACCCCGCGCGAGATGGCGGACTTCCTGCTCGCCGAA
CTCCTCGGCACCCTGCCCACCGACACCGCCGCGACCGTCGCCAGCACGGCCTCCCCCAAG
CTCTCAGCTTCGTTCGAGCAGGGCGGTACCCCCTTCGACGACCCGATCGCCGTCATCGGC
ATCGGCTGCCGCTTCCCCGGCGGCGTCACCACCCCGGAGGAGCTCTGGCAGCTCCTCGAC
GAGGGCCGCGACGGCATCAGCCGCTTCCCCGACGACCGCGGCTGGGACCTCGCCGCGCTG
GGCGCCGGCGCCTCCGACACCCTGGAGGGCGGCTTCCTGACCGGCGTCGCCGACTTCGAC
GCCCGGTTCTTCGGCATCTCGCCCCGCGAGGCGCTGGCCATGGACCCCCAGCAGCGGCTG
CTGCTGGAGACCACCTGGGAGGCGCTGGAGCGGGCCGGCATCGACCCGACCACGCTGCGC
GGCTCCACCACCGGCGTCTTCGTCGGCACCAACGGCCAGGACTACCCGACGCTGTTGCGC
CGCTCCGCCTCGGACGTGGCCGGCTACGTCGCCACCGGCAACACCGCCAGCGTGATGTCC
GGCCGCCTGTCCTACGCGCTCGGCCTCGAAGGCCCGGCCGTCACCATCGACACCGCCTGC
TCCTCCTCGCTCGTCGCCCTGCACTGGGCCGGCCGGGCGCTGCGCGCCGGCGAGTGCGAC
CTCGTGGTGGCCGGCGGCGTCTCGGTCATGGCCAGCCCGGACTCCTTCGTCGAGTTCTCC
ACCCAGGGCGGCCTGGCACCCGACGGGCGCTGCAAGGCGTTCTCCGACGCCGCCGACGGC
ACCGCCTGGTCCGAAGGCGTCGGCATCCTCGTCCTGGAACGCCTCTCCGCCGCCCGCCGC
AACGGCCACCAGGTCCTCGGCCTGATCCGCGGCACCGCCGTCAACCAGGACGGCGCGTCC
AACGGCCTGACCGCGCCCAACGGCCTCTCCCAGCAGCGCGTCATCGCCCAGGCACTCGCC
GACGCCCGCCTGCGCCCCGCCGACATCGACGCGATCGAGGCGCACGGCACCGGCACCACC
CTCGGCGACCCGATCGAGGCCCGCGCCCTGATCACCGCCTACGGCCGGGACCGGGACGCC
GAACGGCCGCTGCTGCTGGGCACCGTCAAGTCCAACATCGGGCACACCCAGGCCGCCGCC
GGTGCCGCCGGCGTCATCAAGATGCTGATGGCGATGCGCCACGGCACCCTGCCCAGGACG
CTGCACGTGGGCACCCCGTCCAGCCACGTCGACTGGAGCGGCGGCACCGTCGCGCTCCTC
GACGACGCGCGGCCCTGGCCACGGACCGGGCAGCCGCGGCGCGCCGGCGTCTCCGCCTTC
GGCGTCAGCGGCACCAACGCCCACGTCGTCGTCGAGCAGGCCCCGGAAACCGAAGCCCCC
GCCGCCCCGGCCGCCGAGCCGGCGCCGGAGGCCACGCCCACCGTCGTCCCCTGGGTCGTC
TCCGGACGCAGCCGGGAAGCGCTCCAGGCGCAGCTGGACCGGCTCACCGCGCACACCGCC
GCCCACCCCGCGCGCTCGGCGGCGGACGTCGGCCGCTCGCTGGCCACCGACCGCACGCTC
TTCCCGCACCGCGCCGTGCTGCTCGCCGGCCCGGACGGGGTGCGCGAGGCCGCCCGCGCC
GCCGCGCCCCGCACCCCCGGCCGCACCGCGTTCCTGTTCTCCGGACAGGGCGCCCAGCAC
GCCCTGATGGGCCACGACCTGTACCAGCGCTTCCCGGTCTACGCCGACGCACTGGACACC
GTCCTCGCCCAGTTCGACACCGTGCTGGACGTCCCGCTGCGCGCCGCGCTGTTCGCCGCG
CCGGGCACCCCCGAGGCCGCGCTCCTGGACCAGACCGGCTTCACCCAGCCCGCGCTGTTC
GCCGTCGAGGTCGCACTGTTCCGGCTCGCCGAGTCCTGGCGGCTGACGCCGGACTTCGTC
GCCGGCCACTCCATCGGCGAGATCGCCGCCGCGCACGTCGCCGGGGTGTTCTCCCTGGAG
GACGCCTGCACGCTGGTCGCCGCCCGCGCCTCCCTCATGCAGCAACTGCCGCGGGACGGT
GCGATGGTGGCCCTGGAAGCCACCGAGGACGAGGTCGCGCCGCTGCTCACCGACGGCGTC
GCACTCGCCGCGGTCAACGGCCCCCGCTCGGTGGTCGTCGCGGGCGCCGAGGACGCCGTC
CGCGCGGTCGCCGACCGGCTCGCCGCCGACGGCCGCCGCACCCGCCGGCTGACGGTCAGC
CACGCCTTCCACTCGCCGCTGATGGACCCGATGCTCACCGACTTCGCCCGGGTCGCGGAG
GGCCTGACCTACCACGAGCCGCGCATCCCCCTCGTCTCCACCCTCCTCGGCGCCCCGGCC
GGCGCCGAACTGCGCACCCCCGACTACTGGGTGCGGCACGTCCGCGAGACCGTGCGGTTC
GCCGACGGCGTGCGCGCCCTGCACGACGCCGGCGCCGGCACCTTCGTGGAGATCGGCCCG
GACGGCGTGCTCACCGCCCTGACCCAGCAGACCCTCGACACCGTCGAGGCCGGCGCGCCC
GCCGTCGTCGTGCCGCTCCAGCGCCGCGACCGCGCCGGCGACCTCGCCCTCCTGGAGGGC
CTGGCCACCCTGCACACCCACGGCACCGGCCCGTCCTGGCCCGCCTACTTCGAGGCCACC
GGCGGCCACCGGACCGATCTGCCCACCTACGCCTTCCAGCGGGAGCGGTACTGGCCCGAA
CTCGGCGCACCCGTCGCCACCGCCCCGCAGGACCCGGCGGCCTGGCGCTACCACGAGACC
TGGGCCCCGCTGCCGGCACCCGAGGCGGCCGCGCCGGCCGGCCGCGCCCTGGTCCTCGTC
CCGGCCGGGAACCGCGACACCGCGTGGATGACGGCCGTCGCCGACGCGCTCGGCGCCGAC
ACCGTCACGGCCGAACCCGACGCCCTGGCCGAGCAGTTGACGGCCGCCGGCGACACACCC
TGGCGCGTCGTGGTGTCGCTGCTCGCCGCCGCGTCCGAGGGGCTGCCCGCGGACGGCGCC
TGGCCCGCCGCCCTCCTCGCCACCCTGGACGAGGCCGGCGTGCACGCGCCCCTGTGGTGC
GTCACCCGCGGCGCCGTCGCGGTCGCGGGGGAGGCCCCGACCGCCGTCGGCCAGGCCGCC
CTGTGGGGCCTGGGCCGGGTCGCCGCGCTGGACCACCCGGACCGCTTCGGCGGCCTGGCC
GACCTGCCCGCCGACACCGACGCGCACGCCGCCGGGCTGCTCGCCGCGCACCTGGCCGCG
CCGGGCACCGAGGCCGAGATCGCGGTCCGCGCCACCGGCGTCCACGCCCGTCGCCTGGTC
CGTACGCCGGCCGCCGCCGACGGTGCCACCTGGCTGCCGACCGGCACCGTCCTGGTTGTC
GGCGGCACCGGCGGCACCGGCACCATGGGCGGCCGGGCCGCCCGCTGGCTGGTCCGCGAG
GGCGCCCGCCACCTCGTCCTGACCGCCCCCGACGGCACCACGACCGCCGCGGACACCGAG
GCCCTGACGGCCGAACTGGCCGCGCTCGGCGCCCGGATCACCGTCGTGGACCACGACCCC
ACCGCCCCGGACGGCTTCGCCGCGCTCCTCGACGGACTGCCCGACGACACCCCGCTCACC
GCGGTCGTGTACGCGCCGGAGGCCGACGCCGCCCCCGGCACCGCGGCCGAGCTGTCCGCC
GCACTCGCCCCCGTCACCGCCCTAGGCGCCGCCCTCACCGGCCGGCCGCTGGACGCCTTC
GTCCTCTTCGGCTCCATCGCCGGGCTCTGGGGCGTGCGCGGCCGGGCCGCCGAGGCCGCG
TCCGGCGCCTACCTCGACGCCTTCGCCCGCGCCTGCCGCGACCGCGGCACCCCGGCACTG
GCCGTCGCCTGGGGCGCCTGGGCCGACCTGGTCGGCCCGTCCCTCGCCGCGCACCTGCGG
ATGAACGGCCTGCCGGTGATGGACGCGGACACCGCACTGACCGCCCTCAGCCGGGCCGTC
GCCGACGGGTCCGCCGCCGAGGCGGTCGCCGACGTCCGCTGGGAGACCTTCGCGCCCCTC
CACCACGAGGCCCGCCGCACCGCCCTGTTCGACGCCCTGCCCGAGGCCCGCGGCGCGCTC
GCGGAGGCCGCCCGGGACCGCGCCGACCGGAAGACCGCCGCCGGCGACTACGGCCGGTGG
CTCGCCGAGCAGCCCGCCGCGGACCACGACGCCATCCTGCTGGCACTGGTCACCGAGAAG
GCCGCGACCGTCCTCGGCCACGCCGACCACGACCTGCTCGAACCCGACCTGCCCTTCCGC
GACCTGGGCTTCGACTCGCTGACCGCGGTCGACCTGCGCAACCAGCTCACCGCGGAAACC
GGCCTCACCCTGCCCGCCACCCTCGTCTTCGACCACCCCAACCCGGCCGCCCTCGCCGCC
CACCTGCGCGCCCAACTCCTCGGCGAGGCGAGCGACTCCGCCGCACCGGTGGCCGCCCCC
GTCGCCCTCGGTGCCGACGACGACGCGATCGTCATCGTCGGCATGGCCTGCCGCTACCCC
GGCGGGGTCACCTCGCCCGAGGACCTGTGGCAGCTGGTCGGCGACGAGGTCGACGCGGTC
GGCGACTTCCCGACCGACCGCGGCTGGGACCTGGCCGCGCTCGCCGGCGACGGACCGGGC
CGCAGTGCCACCGCCCAGGGCGGATTCCTCTACGACGCCACCGACTTCGACCCCGGCCTG
TTCGGCATCTCGCCGCGCGAGGCCCTGGTGATGGACCCGCAGCAGCGGATCCTGCTCGAA
ACGTCCTGGGAGGCCCTGGAGCGGGCCGGCATCGACCCGGCGACGCTGCGCGGCAGCGGC
ACCACCGGCGTCTTCGTCGGCGGCGGCTCCGGCGACTACCGGCCGCCGGAGGAGGCCGGG
CAGTGGCAGACCGCCCAGTCCGCCAGCCTGCTCTCCGGTCGCCTCGCCTACACCTTCGGC
ATCCAGGGCCCCACCGTGTCGGTCGACACCGCCTGCTCCTCGTCGCTGGTCGCGCTGCAC
CTGGCCGCGCAGGCCCTGCGCGCCGGCGAATGCTCGATCGCGCTGGCCGGCGGCGTCACC
GTGATGGCCACCCCGGTGGGCTTCGTCGAGTTCAGCGCCCAGGGCGCCCTGTCGCCGGAC
GGCCGCTGCCGCGCCTTCTCCGACGACGCCAACGGCACCGGCTGGTCCGAAGGCGTGGGC
ATGCTCGTCGTCGAACGGCTCTCCGACGCCCGCCGCAACGGCCACCGCGTCCTCGCCGTG
CTCCGCGGCTCCGCCATCAACCAGGACGGCGCGTCCAACGGCCTGACCGCCCCCAGCGGC
CCCGCCCAGCAGCGCGTCATCCGCCAGGCCCTCGCCAACGCCCGACTGCGCCCCGCCGAC
ATCGACGCCGTCGAGGCCCACGGCACCGGCACCAGGCTCGGCGACCCCATCGAGGCCCAG
GCCCTGCTCGCCACCTACGGCCAGGACCGCGAGCGGCCCGTGCTGCTCGGCTCGCTCAAG
TCCAACATCGGCCACACCCAGGCCGCCTCCGGCGTCGGCGGCGTCATCAAGATGGTCCTC
GCCATGCAGCACGGCGAACTGCCGCGCTCCCTGTACGCCGAGAACCCCTCGTCGCACGTG
GACTGGACCGCCGGCCGCGCCCACCTGCTCACCGCCAGGACCCCGTGGCCCGACTCCGGT
CGGCCGCGCCGCGCCGCCGTCTCCTCCTTCGGCGCCAGCGGCACCAACGCCCACGCCATC
CTGGAGCAGCCGCCGCGCGAGGAACTCCCCGCGCGCCCCGCGGACGACGGCGCCCCGCTG
CCGTTCTTGCTCTCCGGCCGCTCGCAGAACGCCCTGCGCGCCCAGGCCCGCCGACTCCTG
GCCCGCCTCACCGCCCACCCCGACACCCGGGCCGCCGACCTGGCGTACTCCCTGGCGACC
ACCCGGGCCGCCTTCGAGCACCGGGCCGCGATCACCGCCACCGACCACGACGGCCTCCGC
ACCGGCCTGACCGCCGTCGCCGAGGGCACCACCGCCCCGCACACCGCCGAACACCACCTC
CAGGGCACCGGAAAGCGCGCCGTGCTCTTCTCCGGCCAGGGCTCCCAGCGCCTGGGCATG
GGCCGCGAACTGCACGAGCGCCACCCGGTGTTCGCCGAGGCGTTCGACTCCGTACTGGCC
CGCCTCGACGACCGGCTCGACACCCCCCTGCGGGACGTCGTCTGGGGCACCGACGAGGAG
GCGCTGCACGCCACCGGGAACACCCAGCCCGCCCTGTTCGCCGTCGAAGTCGCGCTCTAC
CGCCTGATCGAATCCTGGGGCGTGCGGCCCGACTTCGTGGCCGGCCACTCCGTCGGCGAG
CTCGCCGCGGCCCACGTCGCCGGGGTGCTCTCCCTGGACGACGCCTGCCGCCTGGTCGCC
GCCCGCGCCGCCCTCATGCAGCGCCTCCCGGCCGGCGGCGCCATGATCGCCGTCGAGGCC
ACCGAGGACGAGGTCACCCCGCTCCTCACCGACGGCGTGTCCCTCGCCGCGGTCAACGGA
CCGACCGCCGTGGTCCTCTCCGGCGCGGGCGACGCCGTGACCGCCCTGGGCCAGGCGCTG
GCCGAACGGGGCCACCGCACCACCCGGCTGCGGGTCAGCCACGCCTTCCACTCGCACCTC
ATGGACCCGATGCTGGCGGACTTCCGCACCGTCGCCGAGGGCCTGGAATACCACCCGCCG
CGCATCCCCGTGGTCTCCAACCTCACCGGGGACGTCGCCGACGCGGCCGACCTGTGCTCC
GCCGACTACTGGGTGCGCCACGTCCGCGGCACCGTACGGTTCGCCGACGGCGTGCGCACC
ATGGCCGACCGCGGCGTGCACCTCTTCCTCGAACTCGGCCCGGACGCCGTGCTGTCGGCC
ATGGCCCGCCAGTGCGCACCGGACGCCGTCGTCGTCCCGGCCCTGCGCCGCAACCGCGAC
GAGGACGAGACGCTGGTCGGCGCCGTCGCGCGACTGCACGTCCACGGCGCGGGTCCGCGC
TGGGACGCGTACTTCGCCGGCCGCGGCGCCCAGTGGCTGGACCTTCCGACGTACCCCTTC
CAGCGCGGCCGCTTCTGGCCGGAGTCCCTTCCGGGCGCCGCATCGGCCGCCCCGGCAGCC
GGACAGCCGGCCGAGACCGACGCGGCCTTCTGGGACGCCGTCGCACAGGAGGACTTCACC
GCATTGGAATCCGTACTCGACGTCGAGAGCGACGCACTGTCCAAGGTGCTGCCGGCCCTG
ATGGACTGGCGCAGCCGCCAGGCCGACGAGTCCCAACTGGCAGGCTGGCGCCACCGCATC
GTCTGGAAGCGGCTCACCGGCGCCGCCCTGGCACACCGCAAGGCGCTCAGCGGCACCTGG
CTCGCGGTGGTCCCCGAGGGCTTCGCCGACGACCCCTGGGTGACCACCACCCTGGACGGC
CTCGGTACCCACCTCGTGCATCTGGAGGTCGCGGAGGCCGACCGGGCCGCGCTGGCCGAC
GCGATCGCGGCCCGCACCGCCGACGGCACCCGCTTCGGCGGCGTAATCTCCCTGCTGGCC
CTGCGCGAGGAGCTCACCGGCGCGGTGCCCGAGGGGACCGCCCTGACCACCACCCTCCTC
CAGGCCCTCGGCGACGCCGGCGTCGACGCACCGCTGTGGTGCGTCACCCGCAGCGCCGTC
TCCGCCGGCCGCACCGACCGGCCGCACCGACCGCTCCAAGGCGCCGTCTGGGGCCTGGGC
CGGGTCGCGGCCCTTGAGTACCCGCAGCGCTGGGGCGGCCTGGTGGACCTGCCGGAGGAG
CCCGACGAGCGGTCCGCGGCCGGCCTCGCCGCCGTCCTGGCCGGTCTGGACGGCGAGGAC
CAGGTCGCCGTGCGCGGCACCGCGGTGCTCGCCCGCCGCCTGGTGCCGGCTCCCGGCCGC
AAGCCGTCCCGGCCCTGGCACCCGTCCGGCACCGTCCTGGTCACCGGCGGCACCGGCGCC
CTCGGCGCGCACGTCGCCCGCCGCCTGGCCAAGGACGGCGCCCAGCACCTCGTCCTGCTC
AGCCGCCGCGGCCCGGACGCTCCCGGTGCGGCGGAACTGCGCGCGGAACTGGACGCGTTG
GGCACCGACGTCACGGTCGCCGCCTGCGACGTCGCCGACCGCGACCAGCTGACGGCCGTC
CTGGACGCGCTGCCCGCCGACCGGCCGCTGACCGGTGTGGTGCACACCGCCGGCGTCCTC
GACGACGGCGTACTGGACCGGCTCACCCCCGAGCGGTTCCAGGAGGTGTTCCGCGCCAAG
GTCACCTCGGCCCTGCTGCTGGACGAGCTGACCCGCGACCGCGAGCTGGCCGCGTTCGTC
CTCTTCTCCTCCGCCTCCGCCGCGGTCGGCAACCCGGGCCAGGCCAACTACGCCGCTGCC
AACGCCGTCCTGGACGCGCTCGCCGAACAGCGCCGGGTGCTCGGCCTGCCCGCCACCTCG
GTCTCCTGGGGTGCCTGGGGAGGCGGCGGCATGGCCGACGCCGACGGCGCGGACGAGGCC
GCCCGGCGCGCCGGCGTCGGCGCCATGGACCCGCACCTCGCCGTGGAAGCCCTGCTGCGC
CTGGTCGCCGAGAAGGAGCCGACCGCGGTGGTCGCCGAGGTGGCCCTGGACCGGTTCGCC
GGCGCCTTCGGCGGCAGCCGACCCAGCGCCCTGCTGCGGGAGTTCCCCGGCTACCGCGAG
GCGCTCGCCGCCCAGGCGGAGCAGGCCGCGGACGGCGGCGGGCTGGCCGCCCGACTGGCC
GCGCTGCCGCCCGCCCGCCGCCTGGACACCGTTGTGGACCTGGTGCGCACCCGCGCCGCG
CAGGTGCTCGGCTACCCCGACACCGAAGCGGTCGCCGCCGAACGGTCCTTCCGCGACCTG
GGTGTCGACTCGCTCGGCGCCGTCGAGCTGCGCAACCAACTGAGCGCGGCCACCGGCCTG
AACCTGCCGGCGACGCTGGTGTTCGACCACCCGACCCCCCTGGTCCTGGGGGAGCACATC
CTCGGCGGGCTCTTCCCGGACGAGCCCGCCGGGTCCGACGACGAGACGGAGATCCGGGCC
CTGCTGGCCTCCGTCCCGCTCGACCAACTGCGGGAGATCGGGGTCCTGGAGCCCCTGCTC
CAGCTCGCCGGACGCGGCGGCCGGGCCGCGGACGGCGACGACGGCGAGTCCGTCGACTCG
ATGACAGTGGCAGACCTGGTGCGGGCCGCGCTCAACGGCCAGTCCGACCTGTAG
[9] KS34..398
[9] AT571..886
[9] malonyl-CoA759..763
[9] DH936..1117
[9] KR1443..1619
[9] ACP1720..1790
[10] KS1813..2187
[10] AT2345..2662
[10] malonyl-CoA2534..2538
[10] KR2983..3162
[10] ACP3266..3336
[11] KS3357..3730
[11] AT3895..4215
[11] methylmalonyl-CoA4087..4091
[11] KR4523..4703
[11] ACP4806..4876
[12] KS4901..5276
[12] AT5430..5752
[12] malonyl-CoA5623..5627
[12] KR6068..6247
[12] ACP6348..6418
[13] KS6454..6823
[13] AT6971..7289
[13] malonyl-CoA7161..7165
[13] kr7535..7710
[13] ACP7813..7883
[14] KS7908..8271
[14] AT8429..8738
[14] malonyl-CoA8614..8618
[14] KR9050..9229
[14] ACP9331..9401
[9] KS100..1194
[9] AT1711..2658
[9] malonyl-CoA2275..2289
[9] DH2806..3351
[9] KR4327..4857
[9] ACP5158..5370
[10] KS5437..6561
[10] AT7033..7986
[10] malonyl-CoA7600..7614
[10] KR8947..9486
[10] ACP9796..10008
[11] KS10069..11190
[11] AT11683..12645
[11] methylmalonyl-CoA12259..12273
[11] KR13567..14109
[11] ACP14416..14628
[12] KS14701..15828
[12] AT16288..17256
[12] malonyl-CoA16867..16881
[12] KR18202..18741
[12] ACP19042..19254
[13] KS19360..20469
[13] AT20911..21867
[13] malonyl-CoA21481..21495
[13] kr22603..23130
[13] ACP23437..23649
[14] KS23722..24813
[14] AT25285..26214
[14] malonyl-CoA25840..25854
[14] KR27148..27687
[14] ACP27991..28203

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [559-691]  G3DSA:3.40.366.10 [759-877]  G3DSA:3.40.366.10 [2332-2469]  G3DSA:3.40.366.10 [2534-2648]  G3DSA:3.40.366.10 [3888-4018]  G3DSA:3.40.366.10 [4087-4202]  G3DSA:3.40.366.10 [5422-5555]  G3DSA:3.40.366.10 [5623-5740]  G3DSA:3.40.366.10 [6963-7096]  G3DSA:3.40.366.10 [7161-7278]  G3DSA:3.40.366.10 [8423-8549]  G3DSA:3.40.366.10 [8614-8726]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1748-1763]  PS00012 [3294-3309]  PS00012 [4834-4849]  PS00012 [6376-6391]  PS00012 [7841-7856]  PS00012 [9359-9374]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1724-1789]  1.2e-10 PF00550 [3270-3335]  1.4e-08 PF00550 [4809-4875]  6.1e-11 PF00550 [6351-6417]  1e-13 PF00550 [7817-7882]  2.9e-13 PF00550 [9334-9400]  1.2e-11 PF00550
PF00550   PP-binding
 [1718-1793]  1.60000000000002e-128 G3DSA:1.10.1200.10 [3266-3339]  1.60000000000002e-128 G3DSA:1.10.1200.10 [4803-4880]  1.60000000000002e-128 G3DSA:1.10.1200.10 [6347-6421]  1.60000000000002e-128 G3DSA:1.10.1200.10 [7813-7886]  1.60000000000002e-128 G3DSA:1.10.1200.10 [9329-9401]  1.60000000000002e-128 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1713-1829]  1.50000306971104e-28 SSF47336 [3259-3374]  5.39999384454126e-25 SSF47336 [4799-4917]  1.89999859865865e-27 SSF47336 [6341-6470]  3.60000433965927e-25 SSF47336 [7813-7924]  7.19999557654549e-27 SSF47336 [9322-9408]  1.10000150671642e-20 SSF47336
SSF47336   ACP_like
 [1720-1790]  PS50075 [3266-3336]  PS50075 [4806-4876]  PS50075 [6348-6418]  PS50075 [7813-7883]  PS50075 [9331-9401]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1443-1618]  1.99999999999999e-58 PF08659 [2983-3161]  3.5e-63 PF08659 [4523-4702]  2.89999999999999e-58 PF08659 [6068-6246]  3.29999999999997e-63 PF08659 [7535-7709]  1.40000000000001e-40 PF08659 [9050-9228]  2.20000000000002e-65 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-273]  3.90000000000001e-84 PF00109 [1813-2061]  1.99999999999999e-95 PF00109 [3357-3605]  3.49999999999995e-96 PF00109 [4901-5150]  2.90000000000003e-96 PF00109 [6454-6698]  1.5e-92 PF00109 [7908-8150]  1.5e-87 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [281-398]  5.00000000000001e-45 PF02801 [2069-2187]  7.4e-48 PF02801 [3613-3730]  6.19999999999994e-46 PF02801 [5158-5276]  2.59999999999998e-44 PF02801 [6707-6823]  4.30000000000003e-45 PF02801 [8158-8271]  3.7e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [571-886]  2.99999999999998e-64 PF00698 [2345-2662]  3.99999999999998e-68 PF00698 [3895-4215]  1.10000000000001e-106 PF00698 [5430-5752]  3.99999999999998e-63 PF00698 [6971-7289]  6.49999999999992e-68 PF00698 [8429-8738]  3.10000000000005e-65 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-26]  2e-10 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [567-869]  1.59998835313644e-71 SSF52151 [2341-2645]  4.80002938964646e-70 SSF52151 [3893-4196]  7.29994178862692e-66 SSF52151 [5427-5724]  8.10000734323267e-72 SSF52151 [6968-7259]  3.39999972437719e-69 SSF52151 [8424-8731]  5.89998809405682e-77 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [693-758]  2.30000440726534e-18 SSF55048 [2471-2533]  7.69998480533694e-18 SSF55048 [4021-4086]  4.90001027782405e-19 SSF55048 [5557-5622]  1.29999924468179e-17 SSF55048 [7098-7160]  2.49999811956465e-17 SSF55048 [8551-8613]  2.39999798157265e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-285]  G3DSA:3.40.47.10 [286-452]  G3DSA:3.40.47.10 [1815-2073]  G3DSA:3.40.47.10 [2074-2238]  G3DSA:3.40.47.10 [3360-3617]  G3DSA:3.40.47.10 [3618-3782]  G3DSA:3.40.47.10 [4903-5162]  G3DSA:3.40.47.10 [5163-5328]  G3DSA:3.40.47.10 [6454-6709]  G3DSA:3.40.47.10 [6710-6877]  G3DSA:3.40.47.10 [7910-8162]  G3DSA:3.40.47.10 [8163-8327]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-397]  6.69996745106047e-94 SSF53901 [1805-2185]  5.39997012872478e-102 SSF53901 [3350-3729]  4.89996723796399e-103 SSF53901 [4900-5274]  3.60002015031011e-101 SSF53901 [6453-6876]  1.3000049540733e-102 SSF53901 [7900-8326]  1.79999754022378e-97 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1444-1655]  G3DSA:3.40.50.720 [2983-3168]  G3DSA:3.40.50.720 [4524-4709]  G3DSA:3.40.50.720 [6068-6284]  G3DSA:3.40.50.720 [7532-7708]  G3DSA:3.40.50.720 [9050-9265]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [186-202]  PS00606 [1974-1990]  PS00606 [3518-3534]  PS00606 [5063-5079]  PS00606 [6611-6627]  PS00606 [8063-8079]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [571-868]  8.6000633021393e-123 SM00827 [2345-2642]  2.7000136937899e-129 SM00827 [3897-4195]  1.79999754022378e-123 SM00827 [5431-5732]  4.99996518094122e-128 SM00827 [6972-7271]  5.89998809405682e-121 SM00827 [8429-8719]  SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1721-1793]  9.30000048475975e-35 SM00823 [3267-3339]  9.10000425645573e-33 SM00823 [4807-4879]  9.30000048475975e-30 SM00823 [6349-6421]  4.39999001237725e-34 SM00823 [7814-7886]  2.99998750445706e-34 SM00823 [9332-9404]  4.70000326671387e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [936-1117]  8.19994104549873e-86 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-451]  SM00825 [1815-2239]  SM00825 [3360-3783]  SM00825 [4903-5328]  SM00825 [6456-6876]  SM00825 [7910-8326]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1443-1619]  2.19999900980707e-54 SM00822 [2983-3162]  3.80000697093588e-56 SM00822 [4523-4703]  1.20000117458134e-48 SM00822 [6068-6247]  3.99998544139406e-61 SM00822 [7535-7710]  4.70000326671386e-14 SM00822 [9050-9229]  5.09998762524166e-63 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit