close all open/close all

CDS information : Nysta_00060


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction34,384 / 50,691 / + [in whole cluster]
34,384 / 50,691 / + [in contig]
Location34384..50691 [in whole cluster]
34384..50691 [in contig]
TypeCDS
Length16,308 bp (5,435 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NysJ
Gene
Gene (GenBank)nysJ
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[21764946] New nystatin-related antifungal polyene macrolides with altered polyol region generated via biosynthetic engineering of Streptomyces noursei. (Appl Environ Microbiol. , 2011)

close this sectionPKS/NRPS Module

15 malonyl-CoA
16 malonyl-CoA
17 malonyl-CoA
KS40..415
AT577..886
DH934..1096
ER1427..1730
KR1740..1920
ACP2023..2093
KS2117..2488
AT2633..2950
dh
KR3257..3436
ACP3539..3609
KS3634..4007
AT4151..4469
dh4518..4676
KR4997..5177
ACP5277..5347

close this sectionSequence

selected fasta
>polyketide synthase [NysJ]
MNAPENPETPENNVVAALRAAVKETDRLRRQNRMLVAAAKEPIAVVGMACRFPGAVDSPE
ALWEMVATGTDVISGFPDDRGWDLEALRNSGTDARDTDVSQRGGFLDCIADFDPGFFGIS
PREAVTMDPQQRLLLTTAWEAVERAGIDATTLRATRTGAFIGTNGQDYAYLLVRSLDDAT
GDVGTGIAASAASGRLSYTLGLEGPALTVDTACSSSLVALHLAVQALRNGECGMALAGGV
NVMATPGSLVEFSRQGGLARDGRCKAFADAADGTGWSEGAGVLLLERLSDAQRNGHPVLA
VVRGSAVNQDGASNGFTAPNGPSQQRVIRQALANAGLATGDIDAVEAHGTGTPLGDPIEA
QSILATYGQDRAHPVLLGSIKSNMGHTQAASGVAGVIKMIMAMRHGVLPRTLHVDRPSTH
VDWTTGSVELLTDAHPWPETGRPRRTGISSFGVSGTNAHVIVEQAPDTPAEAADDTPPRT
PRTLPWLLSARTGAALRDQATALLDHLDRPDGDRGPTALDTAFSLATTRAALEHRLAVVT
GTDGTAGRDALTAWLAHGTAPDAHEGHAAGRTRCAALFSGQGAQRLGMGRELHARFPVFA
RALDTAVDLLDAELGGTLREVIWGTDDAPLNETGFTQPALFAVEVALYRLIESWGVAPDF
VAGHSIGEIAAAHVAGVFSLEDACTLVAARAGLMQALPRGGAMVAVEATEDEVSPLLTDG
VAIAAINGPTSLVVSGDETATLAVAARLAEQGRRTTRLRVSHAFHSPLMDPMLAEFRAVA
EGLSYGEPQIPVVSNLTGAVADGTLLGTADYWVRHVREAVRFADGIRALTDAGVGAFLEL
GPDGTLAALAQQSAPDAVSVPVLRKDRDEEPAAVAALARLHTAGVPVDWTAFYAGTGAHR
TDLPTYAFQYERYWPKATYRPADATGLGLTAADHPLLGAAMSVAGSDELLLTGTLSLATH
PWLADHVVGGMVFFPGTGFLELAVRAADQVGCDRVEELMLAAPLILPATGTVQMQIAVGA
ADDDGGRDLRFFTRPGDDPDAAWAQHATGRITEGERVLALDTTTWPPRDAEPVDIDGLYD
RYRANGLDYGPVFRGLRAVWRRDTEIYAEVALPEGTADADAFGLHPALFDAVLHSTLFAS
ADGDDRSLLPFAWNGVSLHAAGADALRVRITSCGPDAVEITAVDPQGRPVVSVESLTLRA
AGPDAGTADHRADAGSLFRMDWTPRTVHAPATPATWAVLGTDPIGLTEALTAAGPDTVTG
LRDGVDALGELTAGDDRPVPDVVAVPLRGATDHGPAGAHDLTRTVLALLQEWLAEERFAR
SRLLLVTRGAVADGERGPLDLAAAPVWGLVRSAQSENPGRLLLVDLDDTAESAAQLPLLP
ALLDADEPQAVVREGTVRVGRLARLDSGRGLVPPPGTPWRLGSRAKGSLDGLALLPHPEA
RRPLTGHEVRVGIRAAGLNFRDVLNALGMYPGDAGLFGSEAAGVVVEVGPEVTGLAPGDR
VMGMLFGGFGPLGIADARLLTPVPADWSWETGASVPLVFLTAYYALKELGGLRAGEKVLV
HAGAGGVGMAAIQIARHVGAEVFATASEGKWDVLRSLGVADDHIASSRTLDFEAAFAEVA
GDRGLDVVLNALSGEFVDASMRLLGDGGRFLEMGKTDIRAADSVPDGLSYHSFDLGMVDP
EHIQRMLLDLVELFDRGALAALPVRSWDVRRAGEAFRFMSLAQHIGKIVLTVPQPLDPDG
TVLLTGGTGGLAGLLARHLVTEHGARHLLLAGRRGPDAPGAAALHAELTALGAEVTVAAC
DVADRTALAALLATVPAEHPLTAVVHTAGVLDDGTLTALNPDRLATVLRPKVDAAWHLHD
LTRHLDLAAFVLYSSTAGVMGGPGQANYAAGNTFLDALAAHRHALGLPATSLAWGAWEQG
AGMTGALTDHDLRRVSDAGGQPLLTAERGLALYDAATAADEPLIVPLGLTGGALPAGVGV
PAVLRGLVRTAGRRARAGTAGVSRAGLAERLAALPEEERTPFLVELVRTEAATVLGHGST
DPVDARREFRQLGFDSLTAIELRNRLGKATGLTLPATLIFDYPTPDRLAVHLHDELLGAD
APVTVTAAAQAADPEHDPVVIVGMSCRFPGGVSSPEELWDLVASGTDAITGFPADRAWDR
HPQLAGAPGARTGQGGFLRDIADFDAAFFGISPREALAMDPQQRILLEVAWEAAERAGID
PQTLRGSDTGVFMGVSGQDYAGLVMRSRDDIAGHATTGLAVSVVSGRLAYALGLEGPALS
VDTACSSSLVSLHLAAQALRAGECTMALAGGVTVMTTAANFTGFSRMGGLAQDGRCKAFS
DSADGTGWSEGAAVLVLERLSDARRAGHRVLAVVRGSAVNQDGASNGLTAPNGPAQQRVI
RQALANAGLTPVDVDAVEAHGTGTPLGDPIEAQALIAAYGTDRDPEHPLLLGSVKSNIGH
TQSAAGAAGLVKMVMAMRHGILPQTLHLTEPSSHVDWSAGTVRLLTERTAWPRTDRPRRA
GVSSFGISGTNAHVILEQPPAEPTPAADPGRPAPTVVAWPVSAQTPAALDAQLDRLRTAA
ALAPLDTAHTLATGRSLFEHRAVLLATVGDPATGAPDLPEVARGAATPHRTAFLFSGQGA
QRSGMGRELHAAFPVFAAAFDEVVAVLDAELGSDADGGVSLREVMWGGGSELLDRTRFTQ
PALFAVEVALFRLVASWGVGPEFVAGHSVGEIAAAHVAGVFSLVDACRLVVARASLMDAL
PVGGVMVAVEAAEAEVVPLLVDGVAIAAVNGPVSVVVSGVEAAVGQVVDQLVERGRRVRR
LAVSHAFHSPLMDPMLDAFRAVAEGLEYHQPRIPVVSNVTGEVAAAEELCAADYWVRHVR
ATVRFADGVRTLAERGATAFLEIGPDGVLSALARGVLPAEALVTPTLRKDRDEESALLAG
LARLHVAGVTVDWSAALTGTGARGTDLPTYAFQRERYWPELAAEPAGGGADAADAEFWAA
VERADATALAAHLDIDGDQLGAVLPALSAWRTRRRTTSATNALRHRESWEPLSLAGTPHT
GGVLVLVPAAATTDPWVADVVAALGPDARRVDVPADGTDRAALAALLTEAADDTAPTAVV
SLLALDETSGDDAVPAGTTATAALVQALADTGAPAPLWALTRGAVAALPDEQPTAPAQAA
VWGLGRIAALELPRHWGGLVDLPADLDERTARRLPAALADAGDEDQLALRATGAYGRRIT
PAPAPDDAPGTGWQPTGTVLITGGTGALGRHTARWLAAHGAEHLLLLSRSGPDAPGAAEL
TTELTALGARVTLVACDAADREQLTRVLAEVPRDCPLTGVVHTAGVLDDGVLTGLTPDRF
ATVFRAKVASAVLLDELTRDTDLAVFALFSSVAGAVGNPGQAGYAAANAVLDALAARRRA
QGLAGTSIAWGAWAGDGMAARHTRPGAEPVGLLDPDLAVPALARAVTEPQPTLVLADLQQ
PRLLESLLALRPSPLLSRLPAARTAARAVQEADRRRAGAAADLRDQLAGTAPADRHAVLL
RLVRTTAAAVLGHTGADAIRADKPFRDLGFDSLTAVELSSALAAATGLALPPSLVFDHPS
PRALADHLRAELTGDRPESAPAAPPAPVPAADDDPIVVVGMACRFPGGVTTPEEFWQLLA
EGRDGIDAFPTDRGWDLDVLGRRRPGPQRPPRSAASSYDAAAFDPGFFDISPREALAMDP
QQRLLLETAWEAVERTGTDPTRLRGSRTGVFVGTNGQDYAGLVLRAQEDVEGHAGTGLAA
SVISGRLAYAFGFEGPAVTVDTACSSSLVALHWAVQALRAGECSLALAGGVTVMTTSTSF
AGFTRQGGLAPDGHCKAFSDSADGTGWSEGVGVLVVERRSDALRNGHEILAVVRGSAVNQ
DGASNGLTAPNGPAQQRVIRQALANAGLAPGDVDAVEAHGTGTVLGDPIEAQALLATYGQ
DRPADRPLWLGSVKSNIGHTQAAAGAAGLMKMVLALQHGTLPRTLHVTEPSTRVDWSAGA
VRLLTERTVWPRTDRPRRAGVSSFGISGTNAHVILEQPPAEPTPTAPADRPTRTPAVLPW
VVSARSATALDAQLARLRAFAAERPDLPPADVAHSLVTSRATFEHRAVLLAAPDGITAAA
RAEARERSTAFLFSGQGAQRSGMGRELHAAFPVFAAAFDEVVAVLDAELATGSGGGVSLR
EVMWGGGSELLDRTRFTQPALFAVEVALFRLVASWGVGPEFVAGHSVGEIAAAYVAGVFS
LVDACRLVVARASLMDALPVGGVMVAVEAAEAEVVPLLVDGVAIAAVNGPVSVVVSGVEA
AVGQVVDQLVERGRRVRRLAVSHAFHSPLMDPMLDAFRAVAEGLEYHQPRIPVVSNVTGE
VAAAEELCAADYWVRHVRATVRFADGVRTLAERGATAFLEIGPDGVLSALAAACLFDTDA
EVVPALRKGRPEEHTALTAAAQLHVAGVDIDWTAVLAGTGGRRIALPTYAFQRERYWPSL
AAQAPGDAGGLGLEAGRHPLLGAATTVAGSAEILLTGRLSTTAQPWLAVYEADGRTVLPA
AVLAELAVRAGDQADCPTVAELTVAAPLVLTGAAAQRLQVRVAAPDDTGRRALSVHARPD
DSPDSPWTLHATAVLTHDTPQPPAPDTGWPPERAVPLDALPTATGPARIAAAWQWGDELC
AEIELPEPGPAERAFALHPALLDTAVRAGGLLDGDATLDALGWRGLALHAASATALRVRL
TPDGTDTWALEATDPQGAPVVSVTGLTLGTPTVDRSGAGAADDGATLLDLEWVPAPQAAP
TGGDHLPYAVLGDQLAELDGQLRIAGDGPGRVASLAALLDGGAPLPRLVLAPVLGVPTGE
GDLPAAVRGTTTAVLELLQRWTADARTADSHLVIVTRGAVAAGAEDVHDLAAAPVWGLVR
SAQSEHPGSFLLLDLDPADPAGASRAAAPATLAALLDAGETQAAVRADTLTVARLTRAAD
GPEATAGHPVRDWDRDGTVLITGGTGGLGGLLARHLVTGHGIKHLLLAGRRGPDAPGARA
LRDELAALGAEVTVAACDVADRAALDRLLAQLPPEHPLTAVVHTAGVLDDATVGTLTPER
LDTVLRAKADAAWHLHDATRDRDLAGFVLYSSVAGVTGGPGQGNYAAGNTFLDALAAHRA
AQGLPGLSLAWGPWGQDAGMTGTLGAADLARLERSGMPPLTPEQGLALFDAAGARGDGFA
VAVRLARGAAAPGADEVPAVLRALVRGRRRTAAAAGHAGVLARRLAALDAEQRHQALLDL
VRTETAAVLGHSGADAVPAERDFNRLGFDSLMAVELRTRLATATGARLPATLVFDHPTPD
AVARHLASTLPGGTAAGPDRSPLAELDRIAAELSPEGADDATRQGVVGRLRHLLAQWDGT
RQDGGGTTVDDRIEAASAEEVLAFIDHELGRQADS
selected fasta
>polyketide synthase [NysJ]
ATGAACGCGCCCGAGAACCCCGAGACCCCCGAGAACAACGTAGTCGCCGCACTCCGCGCC
GCGGTCAAGGAGACCGACCGGCTCCGGCGGCAGAACCGGATGCTGGTCGCGGCGGCCAAG
GAACCGATCGCCGTGGTCGGCATGGCCTGCCGCTTCCCCGGCGCCGTCGACTCCCCGGAA
GCGCTGTGGGAGATGGTCGCCACCGGCACCGACGTGATCTCCGGATTCCCCGACGACCGC
GGCTGGGACCTGGAGGCGCTGCGCAACAGCGGCACCGACGCCCGCGACACCGACGTCAGC
CAGCGCGGCGGATTCCTGGACTGCATCGCCGACTTCGACCCCGGCTTCTTCGGGATCTCA
CCGCGCGAGGCGGTCACCATGGACCCGCAACAGCGGCTCCTGCTGACCACCGCCTGGGAG
GCCGTCGAGCGGGCCGGCATCGACGCCACCACGCTGCGCGCCACCCGCACCGGCGCGTTC
ATCGGCACCAACGGCCAGGACTACGCCTACCTGCTCGTCCGCTCCCTGGACGACGCCACC
GGCGACGTCGGCACCGGCATCGCCGCCAGCGCCGCCTCCGGTCGGCTCTCCTACACCCTC
GGCCTCGAAGGCCCCGCGCTCACCGTCGACACCGCCTGCTCCTCGTCGCTGGTCGCCCTG
CACCTGGCCGTGCAGGCGCTGCGCAACGGCGAGTGCGGCATGGCGCTGGCCGGCGGCGTC
AACGTGATGGCCACACCGGGCTCGCTGGTCGAGTTCAGCCGCCAGGGCGGGCTGGCCCGG
GACGGCCGCTGCAAGGCGTTCGCGGACGCCGCCGACGGCACCGGCTGGTCCGAGGGCGCC
GGCGTGCTGCTGCTGGAACGGCTCTCCGACGCCCAGCGCAACGGCCACCCGGTGCTCGCC
GTGGTCCGCGGCTCCGCCGTCAACCAGGACGGCGCCTCCAACGGCTTCACCGCCCCCAAC
GGCCCCTCCCAGCAGCGCGTCATCCGCCAGGCCCTCGCCAACGCCGGCCTGGCCACCGGC
GACATCGACGCGGTCGAGGCGCACGGGACCGGCACCCCGCTCGGCGACCCCATCGAGGCG
CAGAGCATCCTCGCCACCTACGGCCAGGACCGCGCCCACCCGGTGCTGCTCGGCTCGATC
AAGTCGAACATGGGCCACACCCAGGCCGCGTCCGGCGTCGCCGGCGTGATCAAGATGATC
ATGGCGATGCGGCACGGCGTCCTCCCGCGGACCCTGCACGTCGACCGGCCCTCCACCCAC
GTCGACTGGACCACCGGCAGCGTCGAACTCCTCACCGACGCCCACCCGTGGCCCGAGACT
GGCAGGCCGCGCCGCACCGGCATCTCCTCCTTCGGCGTCAGCGGCACCAACGCCCACGTC
ATCGTCGAACAGGCCCCCGACACCCCCGCCGAGGCGGCTGACGACACTCCGCCCCGCACC
CCGCGGACCCTGCCGTGGCTGCTCTCCGCCCGCACCGGCGCCGCCCTGCGCGACCAGGCC
ACCGCGCTGCTCGACCACCTCGACCGCCCCGACGGCGACCGCGGGCCCACCGCCCTGGAC
ACCGCGTTCTCCCTCGCCACCACCCGCGCCGCCCTGGAACACCGGCTCGCCGTCGTCACC
GGCACCGACGGCACCGCCGGACGGGACGCCCTGACCGCCTGGCTGGCGCACGGCACCGCC
CCCGACGCCCACGAAGGACACGCCGCCGGACGCACCCGCTGCGCGGCCCTCTTCTCCGGC
CAGGGCGCCCAGCGCCTGGGCATGGGCCGCGAACTCCACGCCCGTTTCCCGGTGTTCGCA
CGGGCCCTCGACACCGCCGTGGACCTGCTCGACGCCGAACTGGGCGGCACCCTGCGGGAG
GTGATCTGGGGCACCGACGACGCGCCGCTCAACGAGACCGGCTTCACCCAGCCCGCCCTG
TTCGCCGTCGAGGTCGCCCTCTACCGCCTGATCGAATCCTGGGGCGTCGCCCCGGACTTC
GTCGCCGGCCACTCCATCGGCGAGATCGCCGCCGCGCACGTCGCCGGGGTGTTCTCCCTG
GAGGACGCCTGCACGCTGGTGGCCGCCCGCGCCGGGCTGATGCAGGCGCTGCCGCGCGGC
GGGGCGATGGTCGCCGTCGAGGCCACCGAGGACGAGGTCAGCCCGCTGCTCACCGACGGC
GTCGCGATCGCCGCGATCAACGGCCCCACCTCGCTCGTCGTCTCCGGCGACGAGACCGCC
ACCCTCGCCGTCGCCGCCCGACTCGCCGAACAGGGCCGCCGCACCACCCGGCTGCGGGTC
AGCCACGCCTTCCACTCGCCGCTGATGGACCCGATGCTCGCGGAGTTCCGCGCGGTCGCC
GAGGGCCTGTCCTACGGCGAACCGCAGATCCCGGTGGTCTCCAACCTCACCGGCGCGGTC
GCCGACGGCACCCTGCTCGGCACTGCCGACTACTGGGTCCGGCACGTCCGCGAGGCGGTC
CGCTTCGCCGACGGCATCCGCGCCCTCACCGACGCCGGCGTCGGCGCCTTCCTCGAACTC
GGCCCGGACGGCACGCTCGCCGCCCTGGCCCAGCAGTCCGCCCCCGACGCCGTCTCCGTC
CCCGTCCTGCGCAAGGACCGGGACGAGGAGCCCGCCGCGGTCGCCGCACTGGCCCGGCTG
CACACCGCCGGCGTCCCGGTGGACTGGACGGCGTTCTACGCCGGCACCGGCGCCCACCGC
ACCGACCTGCCGACCTACGCCTTCCAGTACGAGCGCTACTGGCCCAAGGCCACCTACCGG
CCCGCCGACGCCACCGGCCTCGGCCTGACCGCCGCCGACCACCCGCTGCTCGGCGCCGCC
ATGTCCGTCGCCGGGTCCGACGAGCTCCTGCTCACCGGCACCCTGTCGCTCGCCACCCAC
CCCTGGCTCGCCGACCACGTCGTCGGCGGCATGGTCTTCTTCCCCGGCACCGGCTTCCTG
GAACTGGCGGTCCGCGCCGCCGACCAGGTCGGCTGCGACCGGGTCGAGGAACTCATGCTC
GCCGCGCCGCTGATCCTGCCCGCCACCGGCACCGTCCAGATGCAGATCGCGGTCGGCGCC
GCGGACGACGACGGCGGCCGCGACCTGCGCTTCTTCACCCGGCCCGGGGACGACCCGGAC
GCCGCCTGGGCCCAGCACGCCACCGGCCGGATCACCGAGGGCGAGCGCGTCCTCGCCCTC
GACACCACCACCTGGCCGCCCCGCGACGCGGAACCCGTCGACATCGACGGCCTCTACGAC
CGCTACCGCGCCAACGGACTCGACTACGGGCCCGTCTTCCGCGGCCTGCGCGCCGTATGG
CGCCGCGACACCGAGATCTACGCCGAGGTCGCCCTGCCCGAAGGCACCGCCGACGCCGAC
GCCTTCGGCCTGCACCCGGCCCTCTTCGACGCCGTCCTGCACAGCACCCTCTTCGCCTCC
GCCGACGGCGACGACCGCAGCCTCCTGCCGTTCGCCTGGAACGGCGTGTCCCTGCACGCC
GCGGGCGCGGACGCGCTGCGCGTCCGGATCACCAGCTGCGGCCCCGACGCCGTGGAGATC
ACCGCCGTCGACCCGCAGGGCCGCCCCGTCGTCTCCGTCGAATCGCTGACGCTGCGCGCC
GCCGGCCCCGACGCCGGCACCGCCGACCACCGTGCCGACGCGGGCTCCCTCTTCCGCATG
GACTGGACGCCCCGCACCGTCCACGCCCCGGCCACCCCCGCCACCTGGGCCGTCCTCGGT
ACCGACCCGATCGGCCTGACCGAGGCGCTCACCGCCGCCGGCCCCGACACCGTCACGGGA
CTCCGCGACGGTGTCGACGCCCTCGGCGAACTCACCGCCGGCGACGACCGGCCGGTGCCC
GACGTGGTCGCGGTACCGCTGCGCGGCGCCACCGACCACGGGCCGGCCGGTGCCCACGAC
CTGACCCGCACCGTCCTGGCCCTGCTCCAGGAATGGCTGGCCGAGGAGCGCTTCGCCCGC
TCCCGGCTGCTGCTCGTCACCCGCGGCGCGGTCGCCGACGGCGAGCGCGGCCCGCTCGAC
CTGGCCGCCGCCCCGGTCTGGGGCCTGGTGCGCTCCGCCCAGTCCGAGAACCCCGGCCGA
CTGCTGCTCGTCGACCTCGACGACACCGCCGAGTCCGCCGCCCAACTCCCGTTGCTGCCG
GCCCTCCTGGACGCCGACGAGCCGCAGGCCGTGGTCCGCGAGGGCACCGTCCGGGTCGGC
CGGCTCGCCCGCCTGGACTCCGGCCGCGGCCTCGTCCCGCCGCCCGGCACCCCCTGGCGC
CTGGGCAGCCGGGCCAAGGGCAGCCTCGACGGCCTCGCCCTGCTGCCCCACCCCGAGGCC
CGACGACCCCTCACCGGCCACGAGGTCCGCGTCGGCATCCGCGCCGCGGGCCTGAACTTC
CGTGACGTGCTCAACGCGTTGGGGATGTATCCCGGGGATGCGGGGCTGTTCGGTTCGGAG
GCGGCCGGTGTGGTCGTCGAGGTCGGACCGGAGGTCACCGGCCTGGCACCCGGCGACCGG
GTCATGGGCATGCTCTTCGGCGGCTTCGGACCGCTCGGCATCGCCGACGCCCGGCTGCTC
ACCCCCGTCCCGGCCGACTGGTCCTGGGAGACGGGTGCGTCGGTGCCGTTGGTGTTCCTC
ACCGCGTACTACGCCCTGAAGGAGTTGGGTGGTCTGCGGGCGGGGGAGAAGGTGCTGGTG
CATGCCGGTGCCGGTGGTGTCGGTATGGCGGCGATCCAGATCGCCCGGCATGTCGGTGCC
GAGGTGTTCGCCACGGCCAGTGAGGGCAAGTGGGACGTGCTGCGCTCCCTGGGCGTGGCC
GACGACCACATCGCCTCCTCCCGCACCCTCGACTTCGAGGCGGCCTTCGCCGAAGTCGCC
GGCGACCGCGGCCTGGACGTCGTACTGAACGCGCTGTCCGGCGAGTTCGTCGACGCCTCG
ATGCGGCTGCTCGGCGACGGCGGCCGGTTCCTGGAGATGGGCAAGACCGACATCCGCGCC
GCGGACTCCGTTCCCGACGGCCTCTCCTACCACTCCTTCGACCTCGGCATGGTCGATCCG
GAACACATCCAGCGGATGCTGCTCGACCTCGTCGAGCTGTTCGACCGCGGCGCGCTGGCC
GCGTTGCCGGTCCGCAGCTGGGACGTGCGCCGCGCCGGCGAGGCGTTCCGCTTCATGAGC
CTGGCCCAGCACATCGGCAAGATCGTGCTCACCGTGCCGCAACCCCTCGACCCCGACGGC
ACCGTGCTCCTCACCGGCGGCACCGGCGGCCTGGCCGGCCTGCTCGCCCGCCACCTGGTC
ACCGAGCACGGCGCCCGCCACCTGCTGCTGGCCGGCCGGCGCGGCCCCGACGCGCCCGGC
GCCGCCGCACTCCACGCCGAACTGACCGCCCTGGGCGCCGAGGTCACCGTCGCCGCCTGC
GACGTCGCCGACCGCACCGCGCTCGCCGCGCTGCTCGCCACCGTGCCCGCCGAACACCCC
CTCACCGCGGTCGTGCACACCGCCGGCGTCCTGGACGACGGCACCCTCACCGCCCTGAAC
CCCGACCGCCTCGCCACCGTCCTACGGCCCAAGGTGGACGCCGCCTGGCACCTGCACGAC
CTCACCCGCCACCTCGACCTGGCCGCGTTCGTGCTCTACTCCTCCACCGCCGGCGTCATG
GGCGGACCGGGCCAGGCCAACTACGCGGCCGGCAACACCTTCCTCGACGCGCTCGCCGCC
CACCGACACGCCCTCGGCCTGCCCGCCACCTCGCTGGCCTGGGGCGCCTGGGAGCAGGGC
GCCGGCATGACCGGCGCACTGACCGACCACGACCTGCGCCGGGTCAGCGACGCCGGCGGC
CAACCGCTGCTCACCGCCGAACGCGGCCTCGCCCTCTACGACGCCGCCACCGCCGCCGAC
GAACCCCTGATCGTCCCGCTCGGCCTCACCGGCGGTGCGCTGCCCGCCGGGGTCGGCGTC
CCCGCCGTGCTGCGCGGCCTGGTCCGCACCGCGGGCCGCCGGGCCAGGGCCGGCACCGCC
GGCGTCTCCCGCGCCGGCCTCGCCGAACGCCTCGCCGCCCTGCCCGAGGAGGAGCGCACC
CCCTTCCTCGTCGAGCTGGTGCGCACCGAGGCCGCCACCGTCCTCGGCCACGGCTCCACC
GACCCGGTGGACGCCCGCCGCGAGTTCCGCCAACTCGGCTTCGACTCGCTGACCGCCATC
GAACTGCGCAACCGACTCGGCAAGGCCACCGGCCTCACCCTGCCCGCCACCCTCATCTTC
GACTACCCGACCCCCGACCGCCTCGCCGTCCACCTCCACGACGAACTCCTCGGCGCGGAC
GCCCCGGTGACCGTCACCGCCGCCGCACAGGCCGCGGACCCGGAGCACGACCCGGTCGTC
ATCGTCGGCATGAGCTGCCGCTTCCCCGGCGGCGTCAGCTCCCCCGAGGAGCTGTGGGAC
CTGGTGGCATCCGGCACCGACGCGATCACCGGCTTCCCCGCCGACCGCGCATGGGACCGC
CACCCGCAGCTCGCCGGCGCCCCCGGCGCCCGCACCGGCCAGGGCGGATTCCTCCGCGAC
ATCGCCGACTTCGACGCCGCCTTCTTCGGCATCTCGCCGCGCGAGGCCCTGGCCATGGAC
CCGCAGCAGCGCATCCTCCTCGAAGTCGCCTGGGAGGCCGCCGAGCGCGCCGGCATCGAC
CCGCAGACCCTGCGCGGCAGCGACACCGGCGTGTTCATGGGCGTCAGCGGCCAGGACTAC
GCCGGCCTCGTGATGCGCTCCCGCGACGACATCGCCGGCCACGCCACCACCGGCCTCGCC
GTCAGCGTCGTCTCCGGCCGCCTCGCCTACGCGCTCGGCCTGGAGGGCCCGGCCCTGTCC
GTGGACACCGCCTGCTCCTCCTCCCTGGTGTCGCTGCACCTGGCCGCCCAGGCGCTGCGC
GCGGGGGAGTGCACCATGGCCCTGGCCGGCGGCGTCACCGTCATGACCACCGCCGCCAAC
TTCACCGGCTTCTCCCGGATGGGCGGCCTCGCCCAGGACGGCCGCTGCAAGGCGTTCTCC
GACTCCGCCGACGGCACCGGCTGGTCCGAGGGCGCCGCCGTCCTGGTCCTGGAACGCCTC
TCCGACGCCCGGCGCGCCGGCCACCGCGTACTGGCCGTGGTGCGCGGCTCGGCGGTCAAC
CAGGACGGTGCGTCCAACGGTCTGACGGCGCCCAACGGTCCCGCCCAGCAGCGCGTCATC
CGGCAGGCCCTGGCCAACGCGGGCCTGACCCCCGTCGACGTGGACGCCGTCGAGGCGCAC
GGCACCGGCACCCCGCTCGGCGACCCCATCGAGGCCCAGGCCCTGATCGCCGCCTACGGC
ACCGACCGCGACCCCGAACACCCGCTGCTGCTCGGCTCGGTGAAGTCCAACATCGGCCAC
ACCCAGTCCGCGGCCGGCGCGGCCGGGCTGGTCAAGATGGTCATGGCCATGCGCCACGGC
ATCCTGCCGCAGACCCTGCACCTCACCGAACCGTCCTCGCACGTGGACTGGTCGGCGGGC
ACGGTGCGGCTGCTCACCGAGCGGACCGCCTGGCCGCGGACGGATCGTCCGCGTCGGGCC
GGGGTCTCCTCGTTCGGCATCAGCGGCACCAACGCCCACGTCATCCTGGAACAGCCGCCC
GCCGAGCCCACCCCCGCCGCCGACCCGGGCCGGCCCGCACCCACCGTGGTGGCCTGGCCC
GTCTCCGCGCAGACCCCGGCCGCCCTCGACGCCCAACTGGACCGGTTGCGCACCGCCGCC
GCCCTGGCGCCGCTCGACACCGCCCACACCCTCGCCACCGGCCGCTCGCTCTTCGAACAC
CGCGCCGTCCTGCTCGCCACCGTCGGCGACCCGGCGACCGGCGCCCCCGACCTGCCCGAG
GTCGCCAGGGGAGCGGCGACGCCGCACCGCACCGCGTTCCTCTTCTCGGGGCAGGGTGCT
CAGCGGTCGGGGATGGGGCGTGAACTGCATGCTGCTTTCCCGGTGTTCGCGGCGGCGTTC
GACGAGGTGGTGGCTGTGTTGGATGCGGAGCTGGGTTCTGATGCTGATGGGGGTGTGTCG
CTGCGGGAGGTGATGTGGGGCGGGGGGTCGGAGTTGTTGGATCGAACGCGTTTCACGCAG
CCGGCGTTGTTCGCGGTGGAGGTGGCGTTGTTCCGTTTGGTGGCCTCGTGGGGGGTGGGG
CCTGAGTTCGTGGCGGGGCATTCGGTGGGTGAGATTGCGGCGGCGCATGTGGCCGGGGTG
TTCTCGTTGGTGGATGCGTGTCGTTTGGTGGTGGCGCGGGCTTCGTTGATGGATGCGTTG
CCGGTGGGTGGCGTGATGGTTGCGGTGGAGGCGGCCGAGGCGGAGGTGGTGCCGCTGTTG
GTCGATGGGGTGGCGATCGCCGCGGTCAACGGGCCGGTCTCGGTGGTGGTCTCCGGTGTG
GAGGCGGCCGTTGGGCAGGTCGTGGATCAGTTGGTGGAGCGGGGCCGGCGGGTCCGTCGG
TTGGCGGTCAGTCATGCTTTCCACTCGCCGTTGATGGATCCGATGTTGGATGCCTTCCGG
GCCGTCGCCGAGGGCCTGGAGTACCACCAGCCGCGCATCCCCGTGGTGTCCAACGTGACG
GGCGAGGTGGCCGCGGCGGAGGAGCTGTGCGCGGCCGACTACTGGGTGCGGCACGTCCGG
GCGACCGTGCGGTTCGCCGACGGCGTCCGCACCCTGGCCGAGCGCGGCGCCACCGCCTTC
CTGGAGATCGGCCCCGACGGCGTACTGTCCGCGCTCGCCCGCGGCGTCCTGCCCGCCGAG
GCGCTCGTGACGCCCACCCTCCGCAAGGACCGCGACGAGGAGAGCGCCCTGCTCGCCGGA
CTGGCCCGGCTGCACGTCGCCGGCGTGACCGTCGACTGGAGCGCCGCCCTGACCGGCACC
GGCGCGCGCGGCACCGACCTGCCGACCTACGCCTTCCAACGCGAGCGGTACTGGCCGGAG
TTGGCCGCCGAACCCGCGGGCGGCGGCGCGGATGCCGCGGACGCGGAGTTCTGGGCCGCG
GTGGAGCGCGCGGACGCCACCGCGCTCGCCGCCCACCTGGACATCGACGGCGACCAGCTC
GGCGCCGTGCTGCCCGCACTGTCCGCCTGGCGCACCCGGCGCCGCACCACATCGGCCACC
AACGCCCTGCGGCACCGGGAGAGTTGGGAACCGCTGTCGCTCGCCGGCACGCCGCACACC
GGCGGCGTCCTGGTGCTGGTGCCCGCCGCCGCGACCACCGACCCCTGGGTCGCCGACGTC
GTCGCCGCCCTCGGCCCGGACGCCCGCCGGGTGGACGTCCCGGCCGACGGCACCGACCGG
GCCGCGCTCGCCGCCCTGCTCACCGAAGCGGCCGACGACACCGCCCCGACCGCCGTGGTC
TCCCTGCTCGCGCTCGACGAGACCAGCGGCGACGACGCGGTACCGGCCGGCACCACCGCC
ACCGCCGCGCTCGTCCAGGCCCTCGCCGACACCGGCGCCCCGGCCCCGCTGTGGGCCCTG
ACCCGGGGCGCGGTCGCCGCGCTCCCCGACGAGCAGCCGACCGCCCCCGCCCAGGCCGCC
GTCTGGGGCCTCGGCCGGATCGCCGCCCTCGAACTCCCGCGCCACTGGGGCGGACTGGTC
GACCTGCCCGCCGACCTCGACGAGCGCACCGCACGCCGACTGCCCGCCGCACTGGCCGAC
GCCGGCGACGAGGACCAGCTCGCGCTGCGGGCCACCGGCGCCTACGGCCGCCGGATCACC
CCGGCGCCCGCCCCCGACGACGCCCCCGGCACCGGGTGGCAGCCGACCGGCACCGTCCTG
ATCACCGGCGGCACCGGCGCGCTCGGCCGGCACACCGCCCGCTGGCTCGCCGCCCACGGC
GCCGAGCACCTGCTGCTGCTCAGCCGCAGCGGCCCCGACGCGCCCGGCGCGGCCGAACTC
ACCACCGAACTCACCGCCCTCGGCGCCCGCGTCACCCTCGTGGCCTGCGACGCCGCCGAC
CGGGAGCAGCTGACCAGGGTCCTCGCCGAGGTACCGCGGGACTGCCCGCTGACCGGCGTG
GTGCACACCGCCGGAGTGCTCGACGACGGCGTGCTCACCGGCCTCACCCCGGACCGGTTC
GCCACGGTCTTCCGCGCCAAGGTGGCCTCCGCCGTGCTCCTCGACGAGCTGACCCGGGAC
ACCGACCTGGCCGTCTTCGCGCTGTTCTCGTCCGTCGCGGGCGCTGTCGGCAACCCCGGC
CAGGCCGGCTACGCCGCCGCCAACGCGGTCCTCGACGCCCTCGCCGCCCGCCGCCGGGCC
CAGGGCCTGGCCGGCACCTCGATCGCCTGGGGTGCCTGGGCCGGCGACGGCATGGCGGCC
CGTCACACCCGCCCCGGCGCCGAACCCGTCGGCCTGCTCGACCCCGACCTCGCCGTACCG
GCCCTGGCCCGCGCGGTGACGGAGCCCCAGCCCACCCTCGTCCTCGCCGACCTCCAGCAG
CCGCGGCTGCTGGAATCCCTGCTGGCGCTGCGCCCCAGCCCGCTCCTGAGCCGGCTGCCC
GCCGCCCGCACCGCGGCCCGCGCGGTCCAGGAAGCGGACCGCCGCCGAGCCGGCGCCGCG
GCCGACCTGCGCGACCAACTCGCCGGCACCGCACCCGCCGACCGCCACGCCGTCCTCCTC
CGCCTGGTGCGGACCACGGCCGCCGCGGTCCTCGGCCACACCGGTGCCGACGCCATCCGG
GCCGACAAGCCCTTCCGCGACCTCGGCTTCGACTCGCTCACCGCGGTGGAACTGAGCAGC
GCTCTCGCCGCCGCCACCGGCCTGGCCCTCCCGCCCAGCCTCGTCTTCGACCACCCCTCC
CCGCGGGCGCTCGCCGACCACCTGCGCGCCGAACTCACCGGCGACCGGCCGGAATCCGCC
CCCGCGGCCCCGCCGGCACCGGTCCCCGCCGCGGACGACGATCCGATCGTCGTCGTCGGC
ATGGCCTGCCGCTTCCCCGGCGGCGTCACCACCCCCGAGGAGTTCTGGCAGCTGCTCGCC
GAGGGCCGGGACGGCATCGACGCGTTCCCCACCGACCGCGGCTGGGACCTCGACGTGCTC
GGCCGGCGACGGCCAGGGCCACAGCGCCCACCGAGGTCGGCGGCTTCCTCTTACGACGCG
GCCGCCTTCGACCCCGGCTTCTTCGACATCTCCCCGCGCGAGGCGCTCGCCATGGACCCG
CAGCAGCGGCTGCTGCTGGAGACCGCCTGGGAGGCCGTCGAACGCACCGGCACCGACCCG
ACCCGGCTGCGCGGCAGCCGCACCGGCGTGTTCGTCGGCACCAACGGCCAGGACTACGCC
GGCCTCGTCCTGCGCGCCCAGGAGGACGTCGAGGGGCACGCCGGCACCGGACTGGCCGCC
AGCGTGATCTCCGGCCGCCTCGCCTACGCCTTCGGCTTCGAGGGCCCCGCCGTCACCGTC
GACACCGCCTGCTCCTCCTCGCTCGTCGCCCTGCACTGGGCCGTCCAGGCGCTGCGCGCG
GGGGAGTGCTCCCTGGCCCTGGCCGGCGGCGTCACCGTCATGACGACCTCGACGAGCTTC
GCCGGCTTCACCCGGCAGGGCGGCCTGGCGCCGGACGGGCACTGCAAGGCGTTCTCCGAC
TCCGCCGACGGCACCGGCTGGTCCGAGGGTGTGGGCGTCCTCGTCGTCGAACGCCGCTCC
GACGCGCTCCGCAACGGCCATGAGATCCTGGCCGTGGTGCGCGGCTCGGCGGTCAACCAG
GACGGTGCGTCCAACGGTCTGACGGCGCCCAACGGTCCCGCCCAGCAGCGCGTCATCCGG
CAGGCCCTGGCCAACGCGGGCCTGGCCCCCGGCGACGTGGACGCGGTCGAGGCCCACGGC
ACCGGCACCGTCCTCGGCGACCCCATCGAGGCCCAGGCGCTGCTCGCCACCTACGGCCAG
GACCGGCCCGCCGACCGGCCGTTGTGGCTCGGCTCGGTGAAGTCCAACATCGGCCACACC
CAGGCCGCCGCCGGCGCCGCCGGCCTGATGAAGATGGTGCTGGCCCTCCAACACGGCACG
CTGCCGCGCACCCTGCACGTCACCGAGCCCTCGACCCGGGTCGACTGGTCGGCCGGCGCG
GTGCGGCTGCTCACCGAGCGGACCGTCTGGCCGCGGACGGATCGTCCGCGTCGGGCCGGG
GTCTCCTCGTTCGGCATCAGCGGCACCAACGCCCACGTCATCCTGGAACAGCCGCCCGCC
GAGCCCACCCCCACGGCCCCTGCCGACCGCCCCACCCGGACGCCCGCCGTCCTCCCATGG
GTCGTCTCGGCCCGATCGGCCACCGCGCTCGACGCGCAGCTCGCGCGACTGCGGGCGTTC
GCCGCCGAGCGCCCGGACCTGCCGCCCGCCGACGTCGCCCACTCGCTCGTCACCAGCCGC
GCCACCTTCGAACACCGGGCGGTCCTGCTGGCCGCGCCCGACGGCATCACCGCGGCCGCC
CGCGCCGAGGCCCGCGAACGCAGCACCGCGTTCCTCTTCTCGGGGCAGGGTGCTCAGCGG
TCGGGGATGGGGCGTGAACTGCATGCTGCTTTCCCGGTGTTCGCGGCGGCGTTCGACGAG
GTGGTGGCGGTGTTGGATGCGGAGTTGGCGACGGGTTCCGGTGGGGGTGTGTCGCTGCGG
GAGGTGATGTGGGGCGGGGGGTCGGAGTTGTTGGATCGGACGCGTTTCACGCAGCCGGCG
TTGTTCGCGGTGGAGGTGGCGTTGTTCCGTTTGGTGGCCTCGTGGGGGGTGGGGCCTGAG
TTCGTGGCGGGGCATTCGGTGGGTGAGATTGCGGCGGCGTATGTGGCCGGGGTGTTCTCG
TTGGTGGATGCGTGTCGTTTGGTGGTGGCGCGGGCTTCGTTGATGGATGCGTTGCCGGTG
GGTGGCGTGATGGTTGCGGTGGAGGCGGCCGAGGCGGAGGTGGTGCCGCTGTTGGTCGAT
GGGGTGGCGATCGCCGCGGTCAACGGGCCGGTTTCGGTGGTGGTCTCCGGTGTGGAGGCG
GCCGTTGGGCAGGTCGTGGATCAGTTGGTGGAGCGGGGCCGGCGGGTCCGTCGGTTGGCG
GTCAGTCATGCTTTCCACTCGCCGTTGATGGATCCGATGTTGGATGCCTTCCGGGCCGTC
GCCGAGGGCCTGGAGTACCACCAGCCGCGCATCCCCGTGGTGTCCAACGTGACGGGCGAG
GTGGCCGCGGCGGAGGAGCTGTGCGCGGCCGACTACTGGGTGCGGCACGTCCGGGCGACC
GTGCGGTTCGCCGACGGCGTCCGCACCCTGGCCGAGCGCGGCGCCACCGCCTTCCTGGAG
ATCGGCCCCGACGGCGTACTGTCCGCCCTGGCCGCGGCCTGCCTGTTCGACACGGACGCC
GAAGTGGTGCCCGCGCTGCGCAAGGGGCGCCCCGAGGAGCACACCGCCCTCACCGCCGCC
GCCCAACTCCACGTGGCCGGCGTGGACATCGACTGGACCGCGGTCCTGGCCGGCACCGGC
GGGCGGCGGATCGCCCTGCCCACCTATGCCTTCCAGCGCGAGCGGTACTGGCCCTCGCTC
GCCGCACAGGCCCCCGGCGACGCCGGCGGGCTCGGCCTGGAAGCCGGGCGGCACCCGCTG
CTCGGGGCCGCGACCACCGTCGCCGGATCCGCGGAGATCCTGCTCACCGGCCGCCTGTCC
ACCACCGCCCAGCCGTGGCTCGCGGTCTACGAGGCGGACGGCCGCACCGTCCTGCCGGCC
GCGGTCCTCGCCGAACTCGCCGTCCGCGCCGGCGACCAGGCCGACTGCCCGACCGTGGCG
GAACTGACCGTCGCCGCACCGCTCGTCCTCACCGGCGCGGCGGCCCAGCGCCTCCAGGTC
CGGGTGGCCGCCCCCGACGACACCGGCCGGCGCGCGCTGTCCGTGCACGCCCGACCCGAC
GACTCCCCCGACAGCCCCTGGACGCTGCACGCCACCGCGGTCCTCACCCACGACACCCCG
CAGCCCCCGGCGCCGGACACCGGCTGGCCGCCGGAGCGCGCCGTGCCGCTCGACGCCCTG
CCCACCGCCACCGGCCCGGCCCGGATCGCGGCGGCCTGGCAGTGGGGCGACGAACTCTGC
GCCGAGATCGAACTCCCCGAACCCGGCCCGGCGGAGCGGGCATTCGCCCTGCACCCGGCG
CTGCTGGACACCGCGGTCCGCGCCGGCGGCCTGCTGGACGGCGACGCCACCCTGGACGCC
CTCGGCTGGCGGGGCCTCGCCCTGCACGCCGCGTCCGCCACCGCCCTGCGGGTCCGCCTC
ACCCCGGACGGCACGGACACCTGGGCTCTGGAGGCCACCGACCCGCAGGGCGCTCCGGTC
GTCTCCGTCACCGGGCTCACCCTGGGCACGCCCACCGTCGACCGGTCGGGGGCCGGGGCG
GCCGATGACGGCGCGACCCTGCTCGACCTGGAGTGGGTGCCCGCGCCGCAGGCCGCGCCC
ACCGGCGGCGACCACCTCCCGTACGCCGTGCTCGGCGATCAACTCGCGGAGCTGGACGGG
CAGTTGAGGATCGCGGGCGACGGGCCCGGGCGCGTCGCATCGCTGGCCGCGCTGCTGGAC
GGCGGTGCGCCGCTGCCCCGGCTCGTCCTCGCGCCGGTGCTGGGCGTGCCGACCGGGGAA
GGCGACCTGCCCGCCGCGGTGCGCGGCACCACCACGGCGGTGCTGGAGCTGCTGCAGCGC
TGGACCGCCGACGCCCGCACCGCCGACAGCCACCTGGTGATCGTCACCCGCGGCGCCGTC
GCCGCCGGGGCGGAGGACGTGCACGACCTGGCGGCGGCCCCGGTCTGGGGCCTGGTCCGC
TCGGCACAGTCCGAACACCCCGGCAGCTTCCTGCTGCTCGACCTCGACCCCGCCGATCCC
GCGGGAGCCTCCCGCGCCGCCGCGCCGGCCACCCTGGCGGCCCTGCTCGACGCGGGCGAG
ACCCAGGCCGCGGTGCGCGCCGACACGCTCACCGTCGCCCGGCTGACCCGGGCCGCCGAC
GGACCCGAGGCCACCGCCGGACACCCGGTGCGGGACTGGGACCGCGACGGCACCGTCCTG
ATCACCGGCGGCACCGGCGGCCTGGGCGGCCTCCTGGCCCGCCACCTGGTCACCGGACAC
GGCATCAAGCACCTGCTGCTCGCCGGGCGCCGCGGCCCGGACGCCCCCGGCGCGCGGGCC
CTGCGCGACGAACTGGCCGCCCTCGGCGCCGAGGTGACCGTCGCCGCCTGCGACGTGGCC
GACCGTGCCGCACTGGACCGACTCCTCGCGCAACTGCCGCCGGAGCACCCGCTGACCGCC
GTCGTGCACACCGCCGGCGTCCTCGACGACGCCACCGTCGGCACCCTGACGCCCGAGCGG
CTGGACACCGTCCTGCGCGCCAAGGCGGACGCCGCCTGGCACCTGCACGACGCCACCCGC
GACCGCGACCTGGCAGGGTTCGTGCTGTACTCCTCGGTCGCCGGTGTCACCGGCGGCCCC
GGCCAGGGCAACTACGCCGCCGGCAACACGTTCCTCGACGCGCTCGCCGCGCACCGCGCC
GCCCAGGGCCTGCCCGGACTGTCGCTGGCCTGGGGACCGTGGGGGCAGGACGCCGGCATG
ACCGGCACCCTCGGCGCCGCCGACCTGGCCCGCCTGGAGCGCTCCGGCATGCCGCCGCTC
ACCCCGGAACAGGGCCTGGCCCTGTTCGACGCCGCCGGCGCCCGCGGCGACGGGTTCGCG
GTGGCGGTGCGGCTCGCCCGTGGCGCCGCCGCACCGGGCGCCGACGAGGTCCCCGCGGTG
CTGCGTGCCCTGGTGCGCGGCCGGCGCCGCACGGCGGCCGCGGCCGGGCACGCCGGTGTA
CTGGCCCGCCGGCTGGCCGCCCTGGACGCCGAGCAGCGGCATCAGGCGCTGCTCGACCTG
GTCCGCACCGAGACGGCCGCGGTGCTCGGCCACTCCGGGGCGGACGCCGTCCCGGCCGAG
CGGGACTTCAACCGGCTGGGCTTCGACTCGCTGATGGCGGTCGAACTGCGGACGCGGCTG
GCCACCGCCACCGGAGCCCGGCTGCCGGCCACGCTCGTCTTCGACCACCCGACGCCGGAC
GCGGTCGCCCGGCACCTCGCGTCGACGCTGCCCGGTGGGACCGCGGCCGGTCCGGACCGT
TCCCCGCTGGCCGAACTCGACCGGATCGCCGCCGAGTTGTCGCCGGAGGGCGCGGACGAC
GCCACCCGACAGGGCGTCGTCGGGCGGCTGCGGCACCTGCTGGCGCAGTGGGACGGCACC
CGACAGGACGGCGGTGGGACGACCGTCGACGACCGCATCGAAGCGGCGAGCGCCGAAGAG
GTCCTCGCCTTCATCGACCACGAGCTCGGCCGGCAGGCGGACTCCTGA
[15] KS40..415
[15] AT577..886
[15] malonyl-CoA762..766
[15] DH934..1096
[15] ER1427..1730
[15] KR1740..1920
[15] ACP2023..2093
[16] KS2117..2488
[16] AT2633..2950
[16] malonyl-CoA2825..2829
[16] KR3257..3436
[16] ACP3539..3609
[17] KS3634..4007
[17] AT4151..4469
[17] malonyl-CoA4343..4347
[17] dh4518..4676
[17] KR4997..5177
[17] ACP5277..5347
[15] KS118..1245
[15] AT1729..2658
[15] malonyl-CoA2284..2298
[15] DH2800..3288
[15] ER4279..5190
[15] KR5218..5760
[15] ACP6067..6279
[16] KS6349..7464
[16] AT7897..8850
[16] malonyl-CoA8473..8487
[16] KR9769..10308
[16] ACP10615..10827
[17] KS10900..12021
[17] AT12451..13407
[17] malonyl-CoA13027..13041
[17] dh13552..14028
[17] KR14989..15531
[17] ACP15829..16041

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [565-697]  G3DSA:3.40.366.10 [762-872]  G3DSA:3.40.366.10 [2625-2760]  G3DSA:3.40.366.10 [2825-2938]  G3DSA:3.40.366.10 [4142-4278]  G3DSA:3.40.366.10 [4343-4459]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [4997-5164]  1.09999999999999e-62 PF00106
PF00106   adh_short
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [1555-1576]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2051-2066]  PS00012 [3567-3582]  PS00012 [5305-5320]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2016-2133]  1.99999636034521e-27 SSF47336 [3532-3650]  3.1999989904635e-29 SSF47336 [5269-5364]  8.20001307135067e-23 SSF47336
SSF47336   ACP_like
 [2023-2096]  4.09999999999995e-67 G3DSA:1.10.1200.10 [3539-3613]  4.09999999999995e-67 G3DSA:1.10.1200.10 [5275-5350]  4.09999999999995e-67 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [2023-2093]  PS50075 [3539-3609]  PS50075 [5277-5347]  PS50075
PS50075   ACP_DOMAIN
 [2026-2090]  4.1e-11 PF00550 [3542-3608]  2.1e-14 PF00550 [5281-5346]  3.4e-10 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [1421-1573]  8.40001703163684e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1566-1667]  8.59999999999999e-18 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1447-1503]  5.39999999999999e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1740-1919]  6.29999999999998e-64 PF08659 [3257-3435]  9.2000000000001e-65 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [40-291]  1.5e-91 PF00109 [2117-2363]  2.30000000000004e-89 PF00109 [3634-3882]  7.09999999999991e-90 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [299-415]  8.39999999999997e-48 PF02801 [2371-2488]  5.19999999999996e-49 PF02801 [3890-4007]  1.5e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [577-886]  3.99999999999998e-62 PF00698 [2633-2950]  2.50000000000001e-64 PF00698 [4151-4469]  3.60000000000002e-65 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [572-879]  5.20000089003336e-73 SSF52151 [2629-2942]  1.69998802370953e-75 SSF52151 [4148-4453]  8.6000633021393e-75 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [699-761]  5.00000909915354e-17 SSF55048 [2762-2824]  5.20000089003336e-13 SSF55048 [4280-4342]  5.20000089003336e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [40-302]  G3DSA:3.40.47.10 [303-467]  G3DSA:3.40.47.10 [2117-2374]  G3DSA:3.40.47.10 [2375-2541]  G3DSA:3.40.47.10 [3634-3893]  G3DSA:3.40.47.10 [3894-4060]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [33-413]  1.19999063421924e-100 SSF53901 [2109-2487]  2.89997807423186e-103 SSF53901 [3626-4006]  1.79999754022378e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1563-1657]  4.70000000000001e-21 G3DSA:3.40.50.720 [1740-1927]  6.60000000000002e-112 G3DSA:3.40.50.720 [3258-3470]  6.60000000000002e-112 G3DSA:3.40.50.720 [4995-5208]  1.29999999999998e-100 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [204-220]  PS00606 [2276-2292]  PS00606 [3795-3811]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [577-867]  1.39999277195148e-125 SM00827 [2634-2931]  1.09999184471405e-115 SM00827 [4152-4450]  2.50000909916183e-114 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2024-2096]  6.60002751141562e-35 SM00823 [3540-3612]  2.39999798157265e-33 SM00823 [5278-5350]  4.19999771339582e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [934-1096]  1.59998835313644e-83 SM00826 [4518-4676]  2.30000440726534e-48 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [43-467]  SM00825 [2119-2541]  SM00825 [3636-4060]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1740-1920]  7.60000011115808e-67 SM00822 [3257-3436]  4.90001027782408e-62 SM00822 [4997-5177]  7.90003079443025e-63 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1427-1730]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit