close all open/close all

CDS information : Nysta_00080


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction57,095 / 58,279 / + [in whole cluster]
57,095 / 58,279 / + [in contig]
Location57095..58279 [in whole cluster]
57095..58279 [in contig]
TypeCDS
Length1,185 bp (394 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)NysL
Gene
Gene (GenBank)nysL
EC number
Keyword
  • C-10 hydroxylate
Note
Note (GenBank)
  • P450 monooxygenase
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[16597951] Characterization of the P450 monooxygenase NysL, responsible for C-10 hydroxylation during biosynthesis of the polyene macrolide antibiotic nystatin in Streptomyces noursei. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>cytochrome P450 [NysL]
MSTPTAPPSLKAEVPPVLRLSPLLRELQSRAPVCKVRTPAGDEGWLVTRHTELKQLLHDD
RLARAHADPANAPRYVHNPFLDLLVVDDFDLARTLHAEMRSLFTPQFSARRVMDLTPRVE
ALAEGVLAHFVAQGPPADLHNDFSLPFSLSVLCALIGVPAEEQGKLIAALTKLGELDDPA
RVQEGQDELFGLLSGLARRKRITPEDDVISRLCLKVPSDERIGPIASGLLFAGLDSVASH
IDLGTVLFIQHPDQLAAALADEKLMRGAVEEILRSAKAGGSVLPRYATADVPIGDVTIRA
GDLVLLDFTLVNFDRTVFDEPELFDIRRAPNPHLTFGHGMWHCIGAPLARVNLRTAYTLL
FTRLPGLRLVRPVEELRVLSGQLSAGLTELPVTW
selected fasta
>cytochrome P450 [NysL]
ATGAGCACACCGACCGCACCGCCCTCCCTGAAAGCGGAGGTGCCGCCCGTCCTGCGCCTG
AGCCCGCTGCTGCGCGAACTCCAGTCCCGCGCCCCCGTCTGCAAGGTCCGCACCCCCGCC
GGCGACGAGGGCTGGCTGGTGACCCGGCACACCGAACTCAAGCAGCTGCTGCACGACGAC
CGGCTGGCCCGCGCCCACGCCGACCCGGCCAACGCCCCGCGTTATGTGCACAACCCGTTC
CTGGACCTGCTCGTCGTCGACGACTTCGACCTGGCCCGCACGCTGCACGCCGAGATGCGC
TCCTTGTTCACCCCGCAGTTCTCGGCCCGCCGCGTCATGGACCTGACGCCGAGGGTGGAA
GCCCTCGCCGAGGGGGTACTGGCCCACTTCGTCGCCCAGGGACCGCCCGCCGACCTGCAC
AACGACTTCTCGCTGCCGTTCTCCCTGTCGGTGCTGTGCGCGCTCATCGGCGTCCCGGCC
GAGGAACAGGGGAAGCTGATCGCCGCCCTCACCAAACTGGGCGAACTCGACGACCCGGCA
CGCGTCCAGGAAGGCCAGGACGAGCTGTTCGGCCTGCTGTCCGGCCTGGCACGCCGCAAG
CGCATCACACCCGAGGACGACGTCATCTCCCGGCTCTGCCTGAAGGTGCCCTCCGACGAG
CGCATCGGCCCGATCGCCTCCGGTCTGCTCTTCGCCGGCCTGGACAGCGTCGCCAGCCAC
ATCGACCTGGGCACGGTGCTGTTCATCCAGCACCCGGACCAGCTCGCCGCGGCCCTGGCC
GACGAGAAGCTGATGCGCGGCGCCGTCGAGGAGATCCTGCGGTCCGCCAAGGCCGGCGGT
TCGGTGCTCCCGCGGTACGCGACCGCCGATGTACCGATCGGCGACGTGACCATCAGGGCC
GGCGACCTGGTGCTGCTGGACTTCACCCTGGTGAACTTCGACCGCACGGTCTTCGACGAG
CCGGAGCTCTTCGACATCCGGCGCGCCCCCAACCCGCACCTGACGTTCGGCCACGGCATG
TGGCACTGCATCGGCGCGCCGCTGGCCCGGGTCAATCTGCGCACCGCCTACACCCTGCTG
TTCACCCGCCTGCCCGGCCTGCGGCTGGTGCGCCCGGTCGAGGAACTGCGGGTGCTGTCG
GGGCAGTTGTCGGCCGGCCTGACGGAGCTGCCCGTCACCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [11-394]  2.7000136937899e-71 SSF48264
SSF48264   Cytochrome_P450
 [19-394]  1.10000000000001e-80 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [260-362]  2.3e-14 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [138-154]  5.00000909915354e-34 PR00359 [155-170]  5.00000909915354e-34 PR00359 [191-213]  5.00000909915354e-34 PR00359 [267-278]  5.00000909915354e-34 PR00359 [285-312]  5.00000909915354e-34 PR00359 [313-328]  5.00000909915354e-34 PR00359 [334-343]  5.00000909915354e-34 PR00359 [343-354]  5.00000909915354e-34 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit