close all open/close all

CDS information : Nysta_00090


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction58,572 / 58,378 / - [in whole cluster]
58,572 / 58,378 / - [in contig]
Locationcomplement(58378..58572) [in whole cluster]
complement(58378..58572) [in contig]
TypeCDS
Length195 bp (64 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)NysM
Gene
Gene (GenBank)nysM
EC number
Keyword
Note
Note (GenBank)
  • ferredoxin
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
Related Reference
ACC
P18324
PmId
[1846297] Ferredoxins from two sulfonylurea herbicide monooxygenase systems in Streptomyces griseolus. (Biochemistry. , 1991)

close this sectionSequence

selected fasta
>putative ferredoxin [NysM]
MRITVDPGRCVGAGQCVLTAPDLFDQDDDGLVTVLAGAADAADPGDVRDAAALCPSGAIS
VAAD
selected fasta
>putative ferredoxin [NysM]
GTGCGCATCACCGTGGACCCCGGCCGCTGTGTCGGGGCCGGCCAGTGCGTCCTGACCGCA
CCGGACCTGTTCGACCAGGACGACGACGGTCTGGTGACCGTCCTGGCCGGGGCGGCGGAC
GCCGCGGATCCCGGCGACGTACGCGACGCGGCGGCGCTCTGCCCGTCCGGGGCGATCAGC
GTCGCGGCGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [5-16]  1.30000067202732e-06 PR00352 [16-26]  1.30000067202732e-06 PR00352 [47-59]  1.30000067202732e-06 PR00352
PR00352   3FE4SFRDOXIN
IPR010693 Ferredoxin soy-like (Family)
 [1-63]  6.1e-18 PF06902
PF06902   DUF1271
IPR017896 4Fe-4S ferredoxin-type, iron-sulpur binding domain (Domain)
 [1-29]  PS51379
PS51379   4FE4S_FER_2
SignalP No significant hit
TMHMM No significant hit