close all open/close all

CDS information : Nysta_00100


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction59,833 / 58,637 / - [in whole cluster]
59,833 / 58,637 / - [in contig]
Locationcomplement(58637..59833) [in whole cluster]
complement(58637..59833) [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)NysN
Gene
Gene (GenBank)nysN
EC number
Keyword
  • C-16 carboxy group formation
Note
Note (GenBank)
  • P450 monooxygenase
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[21764946] New nystatin-related antifungal polyene macrolides with altered polyol region generated via biosynthetic engineering of Streptomyces noursei. (Appl Environ Microbiol. , 2011)

close this sectionSequence

selected fasta
>cytochrome P450 [NysN]
MSTEADARTAAPQCPVAFPLRRPGRPFPPPEYATYRGGAGLVRSELPSGPVWLVTRHEDV
RAVLTDPRISADPSKPGFPKAGRTGGAPSQYEVPGWFVAMDPPEHGRFRKTLIPEFTVRK
VRELRPVIQQIVDERIDAMLAAGTSADLVESFALPVPSLVISSLLGVPKVDRDFFEDRTR
VLVRLSSTDEERDKATQALLRYLGRLIQIKQRRPGDDLISRLIAAGTLSRQELSGVAMLL
LIAGHETTANNIGLGVVQLLTNPRWIGDDRIVEELLRYYSVADLVAFRVAVEDVEIGGQL
IRAGEGIVPLIAAANHDATAFAAPSEFDPERSARSHVAFGYGVHQCLGQNLVREEMDIAY
RTLFARIPSLTLAVPVEELPLKYDGVLFGLHELPVTWK
selected fasta
>cytochrome P450 [NysN]
ATGAGCACCGAAGCCGACGCGCGGACCGCCGCGCCGCAGTGCCCGGTGGCCTTCCCGCTG
CGCAGGCCGGGCCGGCCCTTCCCCCCGCCGGAGTACGCGACCTACCGCGGCGGGGCGGGC
CTGGTCCGCTCCGAACTCCCCAGCGGCCCGGTCTGGTTGGTGACCCGGCACGAGGACGTC
CGGGCGGTGCTGACCGACCCCCGGATCAGCGCCGACCCCTCCAAACCCGGTTTCCCCAAG
GCCGGTCGGACCGGTGGGGCCCCGTCGCAGTACGAGGTGCCGGGGTGGTTCGTGGCGATG
GACCCACCGGAGCACGGCCGGTTCCGCAAGACCTTGATCCCCGAGTTCACCGTGCGCAAG
GTGCGGGAACTGCGGCCGGTGATCCAGCAGATCGTGGACGAGCGGATCGACGCGATGCTG
GCCGCGGGCACCTCGGCGGACCTCGTCGAGTCCTTCGCGCTGCCGGTGCCGTCCCTGGTG
ATCTCCAGTCTGCTCGGGGTGCCCAAGGTCGACCGGGACTTCTTCGAGGACCGGACCCGG
GTGCTGGTCCGGCTCAGTTCGACCGACGAGGAGCGCGACAAGGCGACCCAGGCGCTGCTG
CGCTATCTGGGCCGACTCATCCAGATCAAGCAGCGGCGACCCGGTGACGACCTGATCAGC
CGGCTGATCGCCGCGGGCACACTGTCCCGGCAGGAGCTGTCCGGGGTGGCGATGCTGCTG
CTGATCGCCGGGCACGAGACGACGGCGAACAACATCGGCCTGGGCGTGGTGCAGTTGCTC
ACCAACCCGCGGTGGATCGGCGACGACCGGATCGTCGAGGAACTGCTGCGCTACTACTCG
GTGGCCGATCTGGTGGCATTCCGGGTGGCCGTCGAGGACGTGGAGATCGGCGGTCAGCTG
ATCCGGGCCGGCGAGGGCATCGTGCCGCTGATCGCCGCCGCCAACCACGACGCCACGGCC
TTCGCGGCGCCCTCGGAGTTCGACCCCGAGCGCTCGGCGCGCTCGCACGTGGCGTTCGGC
TACGGTGTCCACCAGTGCCTGGGCCAGAACCTGGTGCGGGAGGAGATGGACATCGCCTAC
CGCACGCTCTTCGCCCGGATCCCCTCCCTCACGCTCGCCGTGCCGGTGGAGGAACTGCCG
TTGAAGTACGACGGGGTGCTGTTCGGCCTGCACGAACTGCCCGTCACCTGGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [50-264]  5.60000000000001e-05 PF00067 [270-365]  2.2e-18 PF00067
PF00067   p450
 [243-260]  8.80000265836278e-08 PR00385 [270-281]  8.80000265836278e-08 PR00385 [337-346]  8.80000265836278e-08 PR00385 [346-357]  8.80000265836278e-08 PR00385
PR00385   P450
 [24-398]  2.90000000000003e-98 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [8-397]  7.0999832511256e-91 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [100-111]  9.60004130884281e-50 PR00359 [147-163]  9.60004130884281e-50 PR00359 [164-179]  9.60004130884281e-50 PR00359 [201-223]  9.60004130884281e-50 PR00359 [288-315]  9.60004130884281e-50 PR00359 [316-331]  9.60004130884281e-50 PR00359 [337-346]  9.60004130884281e-50 PR00359 [346-357]  9.60004130884281e-50 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [339-348]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-33]  0.302 Signal
Bacteria, Gram-positive   
TMHMM No significant hit