close all open/close all

CDS information : Nysta_00110


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction60,888 / 59,830 / - [in whole cluster]
60,888 / 59,830 / - [in contig]
Locationcomplement(59830..60888) [in whole cluster]
complement(59830..60888) [in contig]
TypeCDS
Length1,059 bp (352 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase
Product (GenBank)NysDII
Gene
Gene (GenBank)nysDII
EC number2.6.1.-
Keyword
  • mycosamine
Note
Note (GenBank)
  • putative aminotransferase
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[17905880] Analysis of the mycosamine biosynthesis and attachment genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455. (Appl Environ Microbiol. , 2007)
Related Reference
ACC
Q93NX0
NITE
Amph_00130
PmId
[16079135] Biosynthesis of amphotericin derivatives lacking exocyclic carboxyl groups. (J Biol Chem. , 2005)
ACC
Q6W5Q8
NITE
FR008_00080
PmId
[14652074] Organizational and mutational analysis of a complete FR-008/candicidin gene cluster encoding a structurally related polyene complex. (Chem Biol. , 2003)

close this sectionSequence

selected fasta
>putative GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase [NysDII]
MSFTYPVSMPWLQGRELDYVTEAVGGGWISSQGPYVRRFEEAFAAYNDVPFGVACSSGTT
ALTLALRALGVGPGDEVIVPEFTMIASAWAVTYTGATPVFVDCGDDLNIDVSRIEEKITP
RTKVIMPVHIYGRQCDMDAVLNLAYEYNLRVVEDSAEAHGVRPRGDIACFSLFANKIISA
GEGGVCLTHDPHLAEQMAHLRAMAFTKDHSFLHKKLAYNFRMTNMQAAVALAQTEQLDTI
LALRRDIEKRYDEALRDIPGITLMPPRDVLWMYDLRAERRDELCAYLAGEGIETRVFFKP
MSRQPGYFSADWPALNAARLSADGFYLPTHTGLTAQEQEFITGRIRAFYGVA
selected fasta
>putative GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase [NysDII]
ATGTCCTTTACGTATCCGGTGTCCATGCCGTGGCTCCAGGGCCGCGAGCTCGACTATGTG
ACGGAGGCCGTCGGCGGCGGCTGGATCTCTTCGCAGGGGCCGTACGTCAGGCGGTTCGAG
GAGGCGTTCGCCGCGTACAACGACGTGCCGTTCGGCGTCGCCTGCTCCTCCGGCACCACG
GCGCTGACGCTGGCGCTGCGCGCGCTGGGCGTCGGCCCCGGTGACGAGGTGATCGTCCCG
GAGTTCACGATGATCGCGTCCGCCTGGGCGGTGACCTACACCGGTGCCACGCCGGTGTTC
GTGGACTGCGGCGACGACCTGAACATCGACGTGTCCCGCATCGAGGAGAAGATCACCCCG
CGCACCAAAGTGATCATGCCGGTGCACATCTACGGCCGGCAGTGCGACATGGACGCCGTG
CTGAACCTGGCGTACGAGTACAACCTGCGGGTGGTGGAGGACTCCGCCGAGGCGCACGGG
GTGCGGCCGCGGGGCGACATCGCCTGTTTCTCGCTCTTCGCCAACAAGATCATCTCGGCC
GGCGAGGGCGGCGTCTGCCTGACCCACGACCCGCACCTGGCCGAGCAGATGGCCCATCTG
CGGGCGATGGCGTTCACCAAGGACCACAGCTTCCTGCACAAGAAGCTGGCCTACAACTTC
CGGATGACCAACATGCAGGCCGCGGTGGCGCTCGCGCAGACCGAGCAGCTGGACACCATC
CTCGCCCTGCGCCGCGACATCGAGAAGCGCTACGACGAGGCGCTGCGCGACATCCCCGGC
ATCACGCTGATGCCGCCGCGCGACGTGCTGTGGATGTACGACCTGCGGGCCGAGCGGCGG
GACGAGCTGTGCGCGTACCTCGCCGGCGAGGGCATCGAGACCCGGGTCTTCTTCAAGCCG
ATGAGCCGTCAGCCCGGTTACTTCTCCGCCGACTGGCCCGCGTTGAACGCGGCCCGGCTC
AGCGCCGACGGCTTCTATCTGCCGACGCACACCGGACTGACCGCACAGGAGCAGGAGTTC
ATCACCGGCCGGATCCGCGCGTTCTACGGAGTGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-352]  5.50001754266469e-89 PIRSF000390
PIRSF000390   PLP_StrS
 [11-343]  2.50000000000001e-101 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [5-233]  2.99999999999998e-76 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [237-349]  5.09999999999998e-19 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [2-352]  3.19999899046355e-103 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit