close all open/close all

CDS information : Nysta_00120


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction62,429 / 60,909 / - [in whole cluster]
62,429 / 60,909 / - [in contig]
Locationcomplement(60909..62429) [in whole cluster]
complement(60909..62429) [in contig]
TypeCDS
Length1,521 bp (506 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductGDP-mycosamine glycosyltransferase
Product (GenBank)NysDI
Gene
Gene (GenBank)nysDI
EC number
Keyword
  • mycosamine
Note
Note (GenBank)
  • putative glycosyltransferase
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[17905880] Analysis of the mycosamine biosynthesis and attachment genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455. (Appl Environ Microbiol. , 2007)
[18798210] The in vitro characterization of polyene glycosyltransferases AmphDI and NysDI. (Chembiochem. , 2008)
[23324745] In vivo investigation of the substrate recognition capability and activity affecting amino acid residues of glycosyltransferase FscMI in the biosynthesis of candicidin. (Mol Biosyst. , 2013)

close this sectionSequence

selected fasta
>GDP-mycosamine glycosyltransferase [NysDI]
MTLPSGNTRLGWRRRRMHSPGDRAGRVRGARARRPATFRGVLSMGANRRPILFVSYAESG
LLNPLLVLAGELSRRDVADLWFATDEKARDEVAAVVDGSPVRFASLGDTVSQMSAVTWDD
ATYAEVTQRSRFKAHAAVIRHSFAPESRMAKYRRLEEIVEEVEPALMVIESMCQFGYELA
ITKGIPFVLGVPFVPSNVLTSHVPFAKSYTPSGFPVPHSGLPAAMSLAQRIENQLFRLRT
LGMFLTSDVRKVVEEDNRVRTELGIAPQARQMMARIDHAEQVLCYSVRELDYPFPMHPKL
RLVGTMVPPLPQAPDDDGLSDWLSAQKSVVYMGFGTITRLTREQVASLVEVARRLDGRGH
QVLWKLPRGQQELLPPAAELPDNLRIEGWVPSQLDVLAHPNVKAFFTHAGGNGYHEGLYF
GKPLVVRPLWVDCDDQAIRGQDFGVSLTLDRPETVDTEDVLDKITRVLDQPSFTERAEHF
AGLLRDAGGRAAAADLLLGLPALATD
selected fasta
>GDP-mycosamine glycosyltransferase [NysDI]
GTGACCCTTCCTTCCGGCAACACGCGCCTCGGGTGGCGGCGTCGGCGAATGCACTCACCC
GGCGACCGGGCCGGGCGGGTGCGTGGCGCGCGGGCCCGGCGGCCCGCCACATTCCGAGGG
GTGTTGTCCATGGGCGCGAATCGGCGGCCGATCCTGTTCGTCAGTTATGCCGAAAGCGGC
CTGCTCAATCCGCTGCTCGTGCTGGCCGGGGAATTGTCCCGGCGCGACGTGGCGGACCTG
TGGTTCGCCACCGACGAGAAAGCGCGCGACGAGGTGGCGGCCGTGGTGGACGGCAGCCCG
GTTCGGTTCGCGTCGCTCGGCGACACCGTCTCGCAGATGTCGGCGGTCACATGGGACGAC
GCGACGTATGCGGAGGTGACGCAGCGGTCGCGGTTCAAGGCGCACGCGGCGGTGATTCGG
CATTCGTTCGCGCCGGAGTCGCGGATGGCGAAGTACCGCCGCCTGGAGGAGATCGTCGAG
GAGGTCGAGCCGGCGCTGATGGTGATCGAGAGCATGTGCCAGTTCGGGTACGAGCTGGCG
ATCACCAAGGGCATTCCGTTCGTGCTCGGGGTGCCGTTCGTGCCGAGCAACGTCCTCACC
TCGCACGTCCCGTTCGCCAAGTCCTACACCCCGTCGGGTTTCCCGGTGCCGCACTCGGGG
CTGCCGGCCGCGATGTCCCTGGCTCAGCGGATCGAGAACCAGCTGTTCCGGCTGCGGACG
CTCGGGATGTTCCTGACGTCGGACGTCCGCAAGGTCGTCGAGGAGGACAACCGGGTCCGC
ACCGAGCTGGGCATCGCGCCCCAGGCGCGGCAGATGATGGCGCGGATCGACCATGCGGAG
CAGGTCTTGTGCTACTCCGTAAGGGAGTTGGACTACCCGTTCCCGATGCATCCGAAGCTG
CGGCTGGTGGGCACGATGGTGCCGCCGCTGCCCCAGGCACCGGACGACGACGGCCTGTCG
GACTGGCTGTCGGCGCAGAAGTCCGTGGTGTACATGGGCTTCGGCACGATCACCCGGCTG
ACCCGTGAGCAGGTGGCGTCGCTGGTGGAGGTCGCCCGGCGACTGGACGGCCGGGGCCAC
CAGGTGTTGTGGAAACTCCCGCGCGGCCAACAGGAGTTGCTGCCGCCGGCCGCCGAGCTG
CCGGACAACCTGCGGATCGAGGGCTGGGTGCCGTCGCAGCTGGACGTGCTGGCCCATCCG
AACGTGAAGGCGTTCTTCACCCATGCCGGTGGCAACGGCTACCACGAGGGCCTGTACTTC
GGAAAGCCGCTGGTGGTCCGGCCGTTGTGGGTGGACTGCGACGACCAGGCGATCCGGGGC
CAGGACTTCGGGGTGAGCCTGACCCTGGACCGGCCGGAGACCGTGGACACCGAGGACGTC
CTGGACAAGATCACCCGCGTGCTCGACCAACCCTCCTTCACCGAGCGCGCGGAGCACTTC
GCCGGGCTGCTGCGGGACGCCGGCGGCCGGGCCGCGGCGGCGGACCTGCTGCTCGGCCTT
CCCGCCCTGGCAACCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [153-483]  9.40000000000003e-31 PF00201
PF00201   UDPGT
SignalP No significant hit
TMHMM No significant hit