close all open/close all

CDS information : Nysta_00130


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction62,659 / 66,759 / + [in whole cluster]
62,659 / 66,759 / + [in contig]
Location62659..66759 [in whole cluster]
62659..66759 [in contig]
TypeCDS
Length4,101 bp (1,366 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NysA
Gene
Gene (GenBank)nysA
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase; contains KS domain with Cys->Ser substitution in the active site
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[21821762] Initiation of polyene macrolide biosynthesis: interplay between polyketide synthase domains and modules as revealed via domain swapping, mutagenesis, and heterologous complementation. (Appl Environ Microbiol. , 2011)

close this sectionPKS/NRPS Module

0 acetyl-CoA
KS8..380
AT527..838
dh882..1049
ACP1213..1283

close this sectionSequence

selected fasta
>polyketide synthase [NysA]
MTIGADEDPVVVVGMACRYPGGVAGPEDLWELVRTGRDATTAFPDDRGWDLAALAGDGPG
RSATREGGFLTGAADFDAAFFGMSPREAVSTDPQQRLVLETAWEALERAGIDPHSLRGSR
TGVFVGASGQDYAAVTHASPDDLDGHALTGLAPGVASGRLAYVLGLEGPAVTVDTTSSSS
LVALHWAVRALRAGECSTALAGGVTVMSTPAAFVGHTRQGGLAPDGRCKPFSDDADGTAW
AEGVGIVVLEHLSTARAAGNPVLAVLRGSAVNQDGASDGLTAPSGPAQERVIRAALADAR
LAPADIDLVEAHGTGTRLGDPVEARALLAAYGQDRDPDRPLRLGSLKSTLGHAQAAAGIG
GVIKTVLTLRHGLMPRIRHLATPTRQVDWSQGAVAPLTDHTPWPPADRPRRAGVSSFGIS
GTNAHVILEEAPPADVPVTRPGTLRPSTVPWPVSAATPEALDAQLARLRAHLRTHSDLDP
LDVGYSLATGRAALRHRAVLLPPADGTAADAVEHARGAAHQRRTAVLFSGQGSQRPGMGR
ELAARFPVFADALDDALRALDRHLDGPVREVMWGTDAALLDRTGWTQPALFAVEVALHRL
VASLGVTPDFVGGHSVGEIAAAHVAGVLSLEDACRLVAARATLMQALPAGGAMAALEATE
DEVAPLLGAHLALAAVNGPTAVVVAGAEDAVRQLTARFADRGRRTSRLAVSHAFHSPLME
PMLDAFRDVVSRLTFHQPSIPLVSNLTGELAGSEITSAEYWVRHVRDTVRFADGITALAK
AGADVLIELGPGGVLSAMARDTLGPDSTTDVVPALSKGRPEETAFAGALGRLHTLGVPVD
WPAFYAGTGARRVELPTYAFQHVRHWPTPPRPNGAGPGALGHPLLGSAVELADGGGTVCS
GALSLRTHPWLADHTVAGRVVLPATALLELAVRAGDEAGCDVLHELHLTTPPALPDDAAL
HVQVHVGPADTTGRRAVTVHTRPDHHPAGDWTRCATGTLGSTPPSAAEAATGGTPAAWPP
ADAEPLDLADHYERLADRGFDYGPTFRGLRAAWRRGAEIFADVECPPGTADDAPDHGLHP
ALLDAARHAAMAVDGTVPVAWHGVRLHAVGATALRVRIRPTTTGTLTLTAVDVHGAPVVT
VEALTARPLTDEERAAPRTPRQARGETPADARPARPAAARPGPAGEPLPDTTGSHPTAGH
LAALPPAARERQLLDLVRTQAAAVLGHPGPEAVGTRSVFKELGFDSLAGVELADRLTART
GLRLPATLVFNFPTPERAAHRLGELLAATAPLDPGAYGEELTRFEAIVTNLPQDGPERRA
VADRLDAIVSALRQNSPAEVPSSDEDIDTVSVDRLLDIIDEEFETT
selected fasta
>polyketide synthase [NysA]
ATGACGATCGGAGCCGACGAGGACCCGGTGGTGGTCGTCGGAATGGCCTGCCGTTATCCG
GGTGGGGTCGCCGGCCCGGAGGACCTGTGGGAACTGGTCCGCACCGGCCGCGACGCGACC
ACCGCCTTCCCGGACGACCGCGGCTGGGACCTGGCCGCACTGGCCGGCGACGGACCCGGC
CGCAGCGCGACCCGCGAGGGCGGATTCCTCACCGGCGCCGCCGACTTCGACGCCGCCTTC
TTCGGCATGTCGCCCCGCGAGGCCGTCTCCACCGACCCGCAACAGCGCCTCGTCCTGGAG
ACCGCCTGGGAAGCCCTGGAGCGCGCCGGCATCGACCCGCACTCCCTGCGCGGCAGCCGC
ACCGGGGTCTTCGTCGGCGCCAGCGGCCAGGACTACGCCGCCGTCACCCACGCCTCGCCC
GACGACCTGGACGGACACGCCCTCACCGGCCTGGCCCCCGGCGTCGCCTCCGGTCGCCTG
GCGTACGTCCTGGGCCTCGAAGGCCCCGCCGTCACCGTCGACACCACGTCCTCCTCGTCG
CTGGTCGCGCTGCACTGGGCGGTCCGCGCCCTGCGCGCGGGGGAGTGCAGCACCGCCCTG
GCCGGCGGCGTCACGGTGATGTCCACCCCGGCCGCCTTCGTCGGCCACACCCGACAGGGC
GGCCTCGCGCCCGACGGCCGCTGCAAGCCGTTCTCCGACGACGCCGACGGCACCGCCTGG
GCGGAGGGCGTCGGCATCGTCGTCCTGGAGCACCTGTCCACCGCCCGCGCCGCCGGCAAC
CCCGTCCTCGCCGTGCTGCGCGGCTCGGCCGTCAACCAGGACGGCGCCTCCGACGGCCTC
ACCGCACCCAGCGGTCCCGCCCAGGAACGCGTCATCCGCGCCGCCCTCGCCGACGCCCGA
CTCGCCCCCGCCGACATCGATCTCGTCGAGGCGCACGGCACCGGCACCCGGCTCGGCGAC
CCCGTCGAGGCCCGGGCGCTGCTCGCCGCCTACGGCCAGGACCGGGACCCGGACCGACCG
CTGCGCCTCGGTTCCCTGAAGTCCACCCTCGGCCACGCACAGGCCGCCGCCGGCATCGGC
GGAGTGATCAAGACCGTCCTGACCCTGCGGCACGGCCTGATGCCGCGCATCCGGCACCTG
GCCACCCCCACCCGCCAAGTCGACTGGTCCCAGGGCGCCGTGGCCCCCCTCACCGACCAC
ACGCCCTGGCCACCGGCCGACCGACCGCGCCGCGCCGGCGTCTCCTCCTTCGGCATCAGC
GGCACCAACGCCCATGTGATCCTCGAAGAGGCGCCGCCCGCCGACGTCCCCGTCACCCGG
CCCGGCACCCTCCGCCCCAGCACCGTCCCCTGGCCGGTCTCCGCCGCCACGCCCGAAGCC
CTCGACGCCCAACTCGCCCGGCTCCGCGCCCACCTGCGCACCCACTCGGACCTGGACCCG
CTGGACGTCGGCTACTCCCTGGCCACCGGCCGCGCCGCGCTCCGCCACCGGGCGGTCCTC
CTGCCGCCCGCCGACGGCACCGCCGCGGACGCCGTCGAGCACGCCCGCGGTGCGGCCCAC
CAGCGCCGCACCGCCGTCCTCTTCTCCGGCCAGGGCAGCCAGCGCCCGGGCATGGGCCGC
GAACTCGCCGCCCGCTTCCCGGTGTTCGCCGACGCACTGGACGACGCGCTGCGCGCCCTG
GACCGGCACCTGGACGGCCCGGTGCGCGAGGTGATGTGGGGCACCGACGCCGCGCTCCTG
GACCGGACCGGCTGGACCCAGCCCGCCCTGTTCGCCGTCGAGGTCGCCCTCCACCGCCTG
GTCGCGTCCCTCGGCGTCACCCCCGACTTCGTCGGCGGCCACTCCGTCGGCGAGATCGCC
GCCGCCCACGTCGCCGGCGTCCTGAGCCTGGAGGACGCCTGCCGCCTGGTGGCCGCCCGC
GCCACGCTGATGCAGGCGCTCCCGGCCGGCGGCGCGATGGCCGCGCTGGAGGCCACCGAG
GACGAAGTGGCCCCGCTGCTCGGCGCACACCTCGCGCTGGCCGCCGTCAACGGCCCCACC
GCGGTCGTCGTCGCCGGAGCCGAGGACGCCGTGCGGCAACTGACCGCCCGCTTCGCCGAC
CGCGGCCGGCGCACCAGCCGGCTGGCCGTCTCGCACGCCTTCCACTCGCCGCTGATGGAG
CCCATGCTCGACGCCTTCCGGGACGTCGTGAGCCGACTGACCTTCCACCAGCCGTCGATC
CCGCTGGTCTCCAACCTCACCGGTGAACTCGCCGGCAGTGAGATCACCAGCGCCGAGTAC
TGGGTCCGGCACGTCCGCGACACCGTCCGCTTCGCCGACGGCATCACCGCACTGGCCAAG
GCCGGCGCCGACGTCCTGATCGAACTCGGCCCCGGCGGCGTGCTGTCCGCGATGGCCCGC
GACACCCTCGGCCCCGACAGCACCACCGACGTCGTCCCCGCCCTGAGCAAGGGACGGCCC
GAGGAGACCGCCTTCGCCGGCGCCCTCGGCCGCCTGCACACCCTCGGCGTCCCCGTCGAC
TGGCCCGCCTTCTACGCCGGCACCGGCGCCCGCCGCGTCGAACTGCCCACCTACGCCTTC
CAGCACGTGCGCCACTGGCCCACCCCGCCCCGCCCGAACGGCGCCGGGCCCGGCGCCCTC
GGCCACCCCCTGCTCGGCTCCGCCGTCGAACTCGCCGACGGCGGCGGCACCGTCTGCTCC
GGCGCCCTCTCCCTCCGCACCCACCCCTGGCTCGCCGACCACACCGTCGCCGGGCGGGTC
GTGCTGCCGGCCACCGCGCTGCTGGAACTCGCCGTGCGCGCCGGCGACGAGGCGGGCTGC
GACGTCCTGCACGAACTCCACCTCACCACCCCGCCGGCCCTGCCCGACGACGCCGCCCTG
CACGTCCAGGTGCACGTCGGCCCCGCCGACACCACCGGGCGCCGCGCCGTCACCGTCCAC
ACCCGCCCCGACCACCACCCGGCCGGCGACTGGACCCGATGCGCCACCGGCACCCTCGGC
AGCACCCCGCCGTCCGCAGCCGAAGCCGCCACGGGCGGCACCCCGGCCGCCTGGCCGCCG
GCCGACGCCGAACCCCTCGACCTCGCCGACCACTACGAACGGCTCGCCGACCGCGGCTTC
GACTACGGCCCGACCTTCCGCGGCCTGCGGGCCGCCTGGCGACGCGGCGCGGAGATCTTC
GCGGACGTGGAATGCCCGCCCGGCACCGCCGACGACGCCCCCGACCACGGACTGCACCCC
GCCCTGCTCGACGCGGCCCGGCACGCCGCCATGGCGGTGGACGGCACCGTGCCCGTCGCC
TGGCACGGCGTCCGGCTGCACGCCGTCGGCGCCACCGCGCTGCGGGTCCGCATCCGCCCC
ACCACGACCGGCACGCTGACCCTCACCGCGGTCGACGTGCACGGCGCGCCGGTCGTCACC
GTCGAGGCCCTCACCGCCCGCCCGCTGACCGACGAGGAACGCGCCGCCCCGCGGACGCCG
CGGCAGGCCCGCGGCGAGACGCCCGCCGACGCCCGCCCGGCCCGGCCCGCGGCGGCCCGC
CCCGGCCCGGCCGGCGAACCCCTCCCGGACACCACCGGGTCCCACCCCACCGCCGGCCAC
CTCGCCGCGCTGCCGCCGGCCGCCCGGGAGCGCCAGCTGCTGGACCTGGTGCGCACCCAG
GCCGCCGCCGTCCTGGGCCACCCCGGCCCCGAGGCCGTCGGCACCCGCAGCGTCTTCAAG
GAGCTGGGCTTCGACTCGTTGGCCGGCGTCGAACTCGCCGACCGGCTCACCGCCCGCACC
GGACTGCGCCTGCCGGCCACCCTCGTCTTCAACTTCCCCACCCCCGAACGTGCTGCCCAC
CGCCTCGGGGAACTCCTCGCCGCAACCGCCCCCCTCGACCCCGGGGCGTACGGAGAGGAA
CTCACCAGGTTCGAGGCGATCGTGACGAACCTGCCGCAGGACGGCCCCGAACGCCGGGCC
GTCGCGGACCGGTTGGACGCCATCGTCTCCGCACTCCGCCAGAACTCGCCTGCAGAGGTG
CCCTCCTCGGACGAGGACATCGACACGGTGTCGGTCGACAGACTGCTCGACATCATCGAT
GAAGAGTTCGAAACCACATAG
[0] KS8..380
[0] AT527..838
[0] acetyl-CoA712..716
[0] dh882..1049
[0] ACP1213..1283
[0] KS22..1140
[0] AT1579..2514
[0] acetyl-CoA2134..2148
[0] dh2644..3147
[0] ACP3637..3849

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [517-647]  9.60000000000003e-78 G3DSA:3.40.366.10 [712-826]  9.60000000000003e-78 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1241-1256]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1205-1300]  1.60000240695997e-20 SSF47336
SSF47336   ACP_like
 [1216-1280]  2.6e-09 PF00550
PF00550   PP-binding
 [1213-1283]  PS50075
PS50075   ACP_DOMAIN
 [1211-1286]  3e-19 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [8-255]  3.60000000000002e-88 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [263-380]  5.69999999999998e-43 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [527-838]  6.49999999999992e-69 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [523-822]  2.7000136937899e-74 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [649-711]  3.50000235434314e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [8-265]  4.2e-87 G3DSA:3.40.47.10 [267-433]  8.89999999999994e-61 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [7-433]  2.0000139277205e-91 SSF53901
SSF53901   Thiolase-like
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [527-819]  1.19999063421924e-125 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1214-1286]  1.10000150671642e-28 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [882-1049]  1.09999184471405e-79 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [10-433]  SM00825
SM00825   PKS_KS
SignalP
 [1-24]  0.094 Signal
Eukaryota   
TMHMM No significant hit