close all open/close all

CDS information : Nysta_00140


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction66,805 / 76,383 / + [in whole cluster]
66,805 / 76,383 / + [in contig]
Location66805..76383 [in whole cluster]
66805..76383 [in contig]
TypeCDS
Length9,579 bp (3,192 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NysB
Gene
Gene (GenBank)nysB
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[23659177] Stereochemistry of reductions catalyzed by methyl-epimerizing ketoreductase domains of polyketide synthases. (J Am Chem Soc. , 2013)
[24161343] Coupled methyl group epimerization and reduction by polyketide synthase ketoreductase domains. Ketoreductase-catalyzed equilibrium isotope exchange. (J Am Chem Soc. , 2013)

close this sectionPKS/NRPS Module

1 methylmalonyl-CoA
2 methylmalonyl-CoA
not conserved YASHS(S->G)
KS41..412
AT575..895
dh
KR1201..1381
ACP1485..1555
KS1579..1955
AT2114..2436
dh
KR2749..2929
ACP3037..3107

close this sectionSequence

selected fasta
>polyketide synthase [NysB]
MQEPQQGQPDQQEKIVDYLRRVTSDLRRARRRIGELESKDNEPIAIVGMGCRLPGGVNSP
ESLWDLVRSGGDAISGFPVDRGWDLETLTGNGDGSSATHEGGFLYDAAEFDAAFFGISPR
EATAMDPQQRLLLEVAWEALERAGIAPTALRGSRSGVFVGSYHWGAPSADAATELHGHAL
TGTAASVLSGRLAYTLGLEGPAVTVDTACSSSLVALHLAAQSLRVGESSLAVIGGVTILT
EPSVFVEFSAQGGLAPDGRCKAFSDAADGTGWAEGVGVLVAERLSDAQRNGHPVLAVLRG
SAVNQDGASNGLTAPNGPSQERVIQQALARTGLTPADIDAVEAHGTGTRLGDPIEAQALL
ATYGQGHTPDQPLWLGSLKSNIGHTQAAAGVAGVIKMVMALRHGHLPPTLHADAPSSHVD
WSAGSVRLLTEGQQWPETGRPRRAAVSSFGISGTNAHALLEQAPHPADTADAGDDAAPTE
PAGAPAALPWIVSGHSPQALRDQAAALAARVETDPALRPQDIGHTLHTARALLERRAVVV
APDRAELLAATHELAAGRSANAVVEGLADVEGRTVFVFPGQGSQWVGMGAQLLDESAVFA
ERIAECAAALAEFTDWSLVDVLRGVVGAPSLERVDVVQPASFAVMVSLAALWGSRGVLPD
AVVGHSQGEIAAAVVSGALSLRDGARVVALRSQAIGRALAGRGGMMSVALSVDVLEPRLV
EFEGRVSVAAVNGPRSVVVAGEPEALDALHARLTADDIRARRIAVDYASHSHQVEDLHEE
LLEVLAELAPRTSEVPFFSTVTGDWLDTARMDAGYWFRNLRGRVRFADAVADLLAAEYRA
FVEVSSHPVLTMAVLDLIEEAGVTAVATGTLRRDQGGAGRFLLSAAEVFVRGVDVDWAGA
FEGTGAARVDLPTYAFQRERYWNTRTAADRTPADAPMDAEFWAAVEQADVSALTAALGTD
EDSVAAILPGLTSWRRARSQRTTLDSWRYRVTWTPLAQVPRATLTGTWLLVTTDGIDDTD
VAGALESYGAEVRRLVLDEECTDRAVLRERLAGAEDVTGIVSVLAAAEDDAARHPGLTRG
LALTVSLVQALGDAEATAPLWFLTRGAFATGPSDPVTRPLQSQIAGVGWTTALEHPQRWG
GTVDLPDTLDARAAQRLAAALSGALGAEDQLAVRAAGVLARRIVRAGHRAGRPARTWAPR
GTTLITGGSGTLAPQLARWLAERGAEHVVLVSRRGADAPGAPELIAEAAESGTEVTVAAC
DITDRDAVAALLADLTADGRTLRTVIHAAAAIELSALADTTVAEFADVVHAKVTGARILD
ELLDDAELDDFVLYSSTAGMWGSGVHAAYVAGNAYLSALAEQRRARGLRTTSIHWGKWPD
DRARELADPHRIRRSGLEYLDPELALTALQHVLDDDETVIGLMDIDWDTYHDVFTAGRPA
HLFDQIPEVRRRLDQASVPDPAGPAADGLAARLHGLAAAEQDRLLLTLVRTEAAAVLGHA
SAESFPERRAFRDLGFDSVTAVDLRNRLVAGTGLRLPSTMVFDHPNCAALAAFLKTTALG
VPGAAPQQHAATGTPADDDPIAVIGMSCRYPGGAATPEELLRLALDGADVISEFPADRGW
DARGLYDPDPDRPGHTYSVQGGFLHEAAGFDPGFFGISPREAVAMDPQQRLLLETSWEAF
ERAGIDPASLRGSAAGTFFGASYQDYSSTVQNGTGESEAHMVTGTAASVLSGRVSYLLGL
EGPAVTVDTACSSSLVALHLACQSLRDGESSLALAGGAAVMATPHAFVGFSRQRALAKDG
RCKPFSDTADGMTLAEGVGVVLLERLSHARANGHRVLAVIRGSAVNQDGASNGLTAPNGP
SQQRVIRQALANAGLTGADVDAVEAHGTGTKLGDPIEAQALLATYGQDRDAERPLLLGSV
KSNIGHTQAAAGVAGVIKMVLAMDAGELPGTLHLDAPSSHVDWTAGAVELLRGRTPWPES
GRPRRAGVSSFGISGTNAHLILEQAPATEPPADPDRLRDTATDTVVPWPLAAKSPAALRA
QAARLLATVEHDPDLPPAPVGHALATTRAALEHRAVVVGERREDFLRGLAALSTGASTAG
LVSGIAGPDPEGAVFVFPGQGSQWWGMGRELLATSEVFRTAIDDCATALAPYVDWSLHDV
LAGEGDPALLERVDVVQPALFAMMVGLSALWRSHGVVPAAVVGHSQGEIAAACVAGALSL
ADAARVVALRSQALPQLSGRGGMMSVSAPVERVTALLAPWQEALSVAAVNGPSSVVVSGD
TDALDALHTACQEQGVRARKVSVDYASHGRHVEAVRDELARVLAPVDPRAPEVPFYSTVT
GDRVDDAAFDGAYWYTNLRQTVRMEEATRALLAAGHRVFIEVSPHPVLAAPIQETQEAVA
EATGGSAVVLGSLRRDEGGPRRFLTSLAEAHTHGAPVDWTTTFARSAYQPVDLPTYPFQR
QDFWPEARPATPAAGADASDAAFWQLVENQDLAALADALGVPADDEHTALGTVLPALSAW
RAKAQARTRIDELRYHVQWTRVAEPAAAPTTGRLLVAVPPDHADAPWVAAALDALGTDTV
RFEAKGTDRAGWAAQIAQLVEDGEEFTGVVSLLAAAEDLHPDFGSVPLGLGQTLVLVQAL
GDAGLTAPLWCLTRGAVATGRDDALDSPTQGALWGLGRVVALEHPDRWGGLIDLPATLDA
RAAARLTGLLADPAGEDQLAVRATGVLARRMVHAAPSAPRTGRRWRGRGTCLITGGTGGI
GGRVARWMAEHGAAHLVLTSRRGPDAPGAAALRAELEALGARVTLAACDVADRDALAALL
ADLPADQPLTSVFHSAGVADGDARAADLTLDQLDALLRAKLTAAHHLHELTAPLDLDAFV
LFSSGAAVWGSGGQPGYAAANAYLDALAAHRRSLDLPGASVAWGTWGEVGMATVPEVHER
LHRQGVRAMEPDHAIGALQQMLEDDDTTLAVTLMDWEAFAPSFTATRPSALFSTVPEAVR
AVTGDPGTTAGDDVDSATPPLRRHLEELSAAERGRALVEAVRAEASATLGHDTPDAIPAG
RAFRDVGFDSVTAVELRNRLRTALGLPLPAALVFDHPTPTALAGHLGALLFGTAPEDAGT
GRPDDPDARIREALATVPIGRLRKAGLLDMVLKLADGDATDAPAPEADAPSESLDDMDAE
ALLRLATENSAN
selected fasta
>polyketide synthase [NysB]
ATGCAGGAACCCCAGCAAGGCCAGCCGGACCAGCAGGAGAAAATCGTCGACTATCTCCGG
CGGGTCACTTCAGATCTTCGCCGTGCCCGCCGCCGCATTGGCGAACTGGAATCCAAGGAC
AACGAGCCCATCGCCATCGTCGGAATGGGCTGCCGACTTCCCGGCGGCGTCAATTCGCCG
GAATCCCTGTGGGACCTGGTGCGTTCCGGCGGCGACGCCATTTCCGGATTCCCCGTCGAC
CGCGGCTGGGACCTGGAAACCCTCACCGGAAACGGCGACGGCAGCAGCGCCACCCACGAA
GGCGGATTCCTCTACGACGCCGCGGAATTCGACGCCGCCTTCTTCGGCATCTCGCCGCGC
GAGGCGACTGCTATGGACCCCCAGCAGCGCCTCCTCCTCGAAGTCGCCTGGGAGGCGCTG
GAGCGCGCCGGCATCGCCCCCACAGCCCTGCGCGGCAGCCGGTCCGGCGTGTTCGTCGGC
TCCTACCACTGGGGCGCGCCCTCGGCCGACGCCGCCACCGAACTGCACGGCCACGCCCTG
ACCGGCACCGCCGCCAGCGTGCTGTCCGGCCGCCTGGCCTACACCCTCGGCCTCGAAGGC
CCGGCCGTCACCGTCGACACCGCCTGCTCCTCCTCCCTCGTCGCCCTGCACCTGGCGGCC
CAGTCCCTGCGCGTCGGCGAATCCTCGCTCGCCGTGATCGGCGGCGTCACGATCCTCACC
GAGCCGTCCGTCTTCGTCGAGTTCAGCGCCCAGGGCGGCCTGGCACCGGACGGCCGCTGC
AAGGCGTTCTCCGACGCCGCCGACGGCACCGGTTGGGCCGAGGGCGTCGGTGTCCTCGTC
GCCGAGCGGCTCTCCGACGCGCAGCGCAACGGCCATCCGGTCCTCGCCGTGCTGCGCGGC
TCCGCCGTCAACCAGGACGGCGCCTCCAACGGCCTGACCGCCCCCAACGGCCCCTCCCAG
GAACGGGTCATCCAGCAGGCCCTCGCCCGGACCGGCCTGACCCCCGCCGACATCGACGCC
GTCGAGGCGCACGGCACCGGCACCCGGCTCGGCGACCCCATCGAGGCCCAGGCCCTGCTC
GCCACCTACGGCCAGGGACACACCCCCGACCAGCCGCTGTGGCTCGGCTCCCTGAAGTCC
AACATCGGGCACACCCAGGCGGCCGCCGGCGTCGCCGGTGTCATCAAGATGGTCATGGCG
CTGCGCCACGGCCACCTGCCGCCGACCCTGCACGCCGACGCGCCCTCCTCGCACGTGGAC
TGGTCCGCCGGATCGGTACGCCTGCTGACCGAGGGCCAGCAGTGGCCGGAGACCGGACGT
CCGCGCCGGGCCGCGGTGTCCTCGTTCGGCATCAGCGGCACCAACGCGCACGCCCTGCTG
GAACAGGCACCCCACCCCGCGGACACCGCGGACGCCGGCGACGACGCCGCGCCCACCGAA
CCGGCCGGCGCGCCCGCCGCGCTGCCCTGGATCGTCTCCGGACACTCCCCGCAGGCGCTG
CGCGACCAGGCCGCCGCCCTGGCCGCCAGGGTCGAGACCGACCCCGCGCTCCGCCCCCAG
GACATCGGGCACACCCTGCACACCGCCCGCGCCCTGCTCGAACGACGCGCCGTCGTCGTC
GCCCCCGACCGCGCCGAACTCCTCGCGGCTACCCACGAGTTGGCCGCCGGCCGGTCCGCG
AACGCCGTCGTCGAGGGCCTCGCGGACGTCGAGGGTCGGACGGTGTTCGTGTTCCCCGGT
CAGGGTTCGCAGTGGGTGGGGATGGGGGCCCAACTCCTCGATGAGTCGGCGGTGTTCGCG
GAGCGGATTGCCGAGTGTGCGGCGGCACTCGCCGAGTTCACCGACTGGTCGCTGGTCGAT
GTGCTGCGGGGTGTGGTGGGTGCGCCGTCGTTGGAGCGGGTCGATGTGGTGCAGCCGGCG
TCGTTCGCGGTGATGGTGTCGTTGGCTGCGTTGTGGGGTTCCCGTGGTGTGTTGCCGGAT
GCGGTGGTGGGGCATTCGCAGGGTGAGATCGCTGCCGCGGTGGTGTCGGGTGCGCTGTCG
TTGCGGGACGGGGCGCGGGTGGTGGCGCTGCGGAGTCAGGCCATTGGTCGTGCGTTGGCG
GGGCGGGGCGGGATGATGTCCGTCGCGCTGTCGGTGGACGTGCTCGAACCGCGGTTGGTC
GAGTTCGAGGGGCGGGTGTCGGTGGCCGCCGTCAACGGCCCGCGCTCCGTCGTGGTCGCC
GGCGAGCCCGAGGCGCTGGACGCGCTGCACGCCCGGCTGACCGCCGACGACATCCGGGCC
CGCCGGATCGCGGTGGACTACGCCTCGCACTCGCACCAGGTCGAGGACCTGCACGAGGAA
CTGCTGGAGGTGCTGGCGGAGCTGGCGCCGCGCACGTCGGAGGTGCCGTTCTTCTCGACC
GTGACCGGCGACTGGCTGGACACCGCGCGGATGGACGCCGGCTACTGGTTCCGCAACCTG
CGCGGACGGGTGCGGTTCGCGGACGCGGTGGCGGACCTGCTGGCGGCGGAGTACCGCGCG
TTCGTCGAGGTCAGCTCGCACCCGGTGCTGACGATGGCGGTCTTGGACCTGATCGAGGAG
GCCGGGGTCACGGCCGTCGCGACCGGCACCCTGCGCCGTGACCAGGGTGGCGCGGGCCGC
TTCCTGCTGTCGGCCGCCGAGGTCTTCGTGCGCGGTGTGGACGTGGACTGGGCGGGGGCG
TTCGAGGGGACCGGTGCGGCCCGGGTCGACCTGCCCACCTACGCCTTCCAGCGCGAGCGG
TACTGGAACACCCGCACCGCCGCCGACCGCACCCCGGCCGACGCCCCGATGGACGCCGAA
TTCTGGGCCGCCGTCGAACAGGCGGACGTCTCCGCGCTGACCGCCGCGCTCGGCACCGAC
GAGGACTCCGTCGCCGCCATCCTGCCCGGCCTCACCTCCTGGCGCCGGGCCCGCTCCCAG
CGCACCACCCTCGACTCCTGGCGCTACCGCGTCACCTGGACGCCCCTCGCCCAGGTGCCC
CGCGCCACCCTGACCGGCACCTGGCTGCTGGTCACCACCGACGGCATCGACGACACCGAT
GTGGCAGGGGCGTTGGAGAGCTACGGCGCCGAGGTGCGCCGGCTGGTCCTGGACGAGGAG
TGCACCGACCGCGCCGTCCTGCGGGAGCGGCTGGCCGGCGCGGAGGACGTGACCGGCATC
GTCTCCGTCCTCGCCGCCGCCGAGGACGACGCCGCACGCCACCCCGGCCTCACCCGGGGA
CTCGCGCTCACCGTCTCCCTCGTCCAGGCCCTGGGCGACGCCGAGGCGACCGCGCCGCTG
TGGTTCCTGACCCGCGGCGCCTTCGCCACCGGCCCGTCCGACCCCGTCACCCGGCCCCTG
CAGAGCCAGATCGCGGGCGTCGGCTGGACCACCGCGCTGGAGCACCCGCAGCGCTGGGGC
GGCACCGTGGACCTGCCCGACACCCTCGACGCCCGGGCCGCCCAGCGGCTCGCCGCCGCG
CTGTCCGGCGCCCTCGGCGCCGAGGACCAGCTCGCCGTCCGCGCCGCCGGGGTACTGGCC
CGCCGCATCGTGCGTGCCGGACACCGCGCCGGACGACCGGCACGGACCTGGGCGCCGCGC
GGCACCACCCTGATCACCGGCGGCTCCGGCACCCTCGCCCCGCAGCTCGCCCGCTGGCTG
GCCGAACGCGGCGCCGAGCACGTGGTGCTGGTCAGCCGGCGCGGTGCCGACGCCCCCGGA
GCGCCCGAACTCATCGCGGAGGCAGCCGAGTCGGGCACCGAGGTGACCGTCGCCGCCTGC
GACATCACCGACCGCGACGCGGTCGCCGCGCTGCTGGCCGACCTCACGGCCGACGGCCGC
ACCCTGCGCACCGTCATCCACGCCGCCGCCGCCATCGAGCTGTCCGCGCTCGCCGACACC
ACCGTGGCGGAGTTCGCCGACGTCGTGCACGCCAAGGTCACCGGCGCACGGATCCTCGAC
GAACTGCTCGACGACGCGGAACTGGACGACTTCGTCCTGTACTCCTCCACCGCCGGCATG
TGGGGCAGCGGCGTGCACGCCGCCTACGTCGCCGGCAACGCCTATCTGTCCGCGCTCGCC
GAGCAGCGCCGCGCCCGCGGACTGCGCACCACCTCCATCCACTGGGGCAAGTGGCCCGAC
GACCGGGCACGCGAGCTGGCCGACCCGCACCGGATCCGCCGCAGCGGTCTGGAGTACCTC
GACCCCGAGCTGGCGCTCACCGCGCTCCAGCACGTCCTGGACGACGACGAGACCGTCATC
GGCCTCATGGACATCGACTGGGACACCTACCACGACGTGTTCACCGCGGGCCGGCCCGCG
CACCTCTTCGACCAGATCCCCGAGGTGCGGCGCCGCCTCGACCAGGCATCCGTCCCGGAC
CCCGCGGGCCCGGCCGCCGACGGCCTGGCCGCCCGCCTGCACGGCCTCGCCGCCGCCGAA
CAGGACCGGCTGCTGCTCACCCTGGTCCGCACCGAGGCCGCCGCCGTCCTCGGCCACGCC
TCGGCCGAGTCCTTCCCCGAGCGCCGCGCCTTCCGTGACCTCGGCTTCGACTCGGTCACC
GCCGTGGACCTGCGCAACCGGCTCGTGGCCGGCACCGGACTGCGGCTGCCCTCGACGATG
GTCTTCGACCACCCCAACTGCGCGGCGCTCGCCGCGTTCCTGAAGACGACGGCGCTCGGC
GTCCCCGGCGCCGCACCGCAGCAGCACGCCGCTACCGGCACCCCGGCCGACGACGACCCG
ATCGCCGTGATCGGCATGAGCTGCCGCTACCCCGGCGGCGCCGCCACCCCCGAGGAACTG
CTGCGGCTCGCCCTCGACGGCGCCGACGTCATCTCGGAGTTCCCCGCGGACCGCGGCTGG
GACGCCCGGGGCCTGTACGACCCGGACCCCGACCGCCCCGGCCACACCTACTCCGTCCAG
GGCGGCTTCCTCCACGAGGCCGCCGGCTTCGATCCCGGCTTCTTCGGGATCTCCCCGCGC
GAGGCGGTCGCCATGGACCCGCAGCAGCGGCTCCTGCTGGAGACCTCCTGGGAGGCGTTC
GAACGCGCCGGTATCGACCCCGCGTCACTGCGCGGCAGCGCCGCCGGCACCTTCTTCGGC
GCCAGCTACCAGGACTACTCCTCCACCGTGCAGAACGGCACGGGGGAGTCCGAGGCGCAC
ATGGTGACCGGCACCGCGGCCAGTGTCCTGTCCGGCCGGGTCTCCTACCTGCTCGGCCTG
GAGGGCCCCGCGGTCACCGTGGACACCGCCTGCTCCTCCTCACTGGTCGCCCTGCACCTG
GCCTGCCAGTCCCTGCGCGACGGCGAGAGCTCCCTCGCGCTGGCCGGCGGTGCGGCCGTG
ATGGCCACCCCGCACGCGTTCGTCGGCTTCAGCCGGCAGCGTGCCCTGGCCAAGGACGGC
CGCTGCAAGCCGTTCTCCGACACCGCCGACGGCATGACGCTCGCCGAGGGCGTCGGCGTC
GTCCTGCTGGAGCGCCTGTCCCACGCCCGCGCCAACGGGCACCGGGTACTGGCCGTGATC
CGCGGTTCCGCCGTCAACCAGGACGGCGCCTCCAACGGCCTGACCGCGCCCAACGGCCCG
TCCCAGCAGCGCGTCATCCGCCAGGCGCTCGCCAACGCCGGCCTGACCGGCGCCGACGTC
GACGCGGTCGAGGCGCACGGCACCGGCACCAAGCTGGGCGACCCCATCGAGGCCCAGGCC
CTGCTCGCCACCTACGGCCAGGACCGCGACGCCGAACGGCCGCTGCTGCTGGGCTCGGTG
AAGTCCAACATCGGCCACACCCAGGCCGCGGCCGGCGTCGCCGGCGTCATCAAGATGGTG
CTGGCCATGGACGCCGGCGAACTGCCCGGCACCCTGCACCTCGACGCGCCCTCCAGCCAC
GTCGACTGGACCGCCGGCGCCGTGGAACTGCTGCGCGGGCGCACCCCGTGGCCCGAGAGC
GGGCGCCCCCGCCGGGCCGGTGTCTCCTCGTTCGGCATCAGCGGCACCAACGCCCACCTG
ATCCTCGAACAGGCCCCGGCCACCGAGCCGCCAGCCGACCCCGACCGCCTCCGGGACACC
GCCACCGACACCGTCGTCCCCTGGCCGCTCGCCGCCAAGTCCCCGGCCGCCCTGCGCGCC
CAGGCCGCCCGGCTCCTCGCCACCGTCGAGCACGACCCCGACCTCCCGCCCGCCCCCGTG
GGCCACGCCCTGGCCACCACCCGCGCCGCCCTCGAACACCGCGCCGTCGTCGTCGGCGAG
CGCCGCGAGGACTTCCTGCGCGGCCTGGCCGCCCTGTCCACCGGCGCCTCGACGGCCGGC
CTGGTCAGCGGCATCGCCGGCCCCGACCCCGAGGGAGCGGTCTTCGTCTTCCCCGGCCAG
GGATCCCAGTGGTGGGGAATGGGCCGCGAACTCCTCGCCACGTCCGAGGTGTTCCGCACC
GCGATCGATGACTGCGCGACGGCCCTCGCCCCGTACGTCGACTGGTCGCTGCACGACGTC
CTGGCCGGCGAGGGCGACCCCGCCCTGCTGGAGCGGGTGGACGTGGTCCAGCCCGCGCTG
TTCGCCATGATGGTCGGGCTGTCCGCGCTCTGGCGCTCCCACGGCGTCGTCCCGGCGGCC
GTGGTCGGCCACTCGCAGGGCGAGATCGCCGCGGCCTGCGTCGCCGGAGCCCTCAGCCTG
GCCGACGCCGCCCGCGTGGTGGCGCTGCGCAGCCAGGCACTGCCGCAACTGTCCGGACGC
GGCGGCATGATGTCGGTCTCCGCCCCCGTAGAGCGGGTCACCGCACTCCTCGCCCCGTGG
CAGGAGGCGCTGTCCGTCGCCGCGGTCAACGGCCCCTCGTCCGTGGTCGTCTCCGGCGAC
ACCGACGCGCTCGACGCCCTGCACACCGCCTGCCAGGAACAGGGCGTGCGGGCCCGCAAG
GTGTCCGTGGACTACGCCTCGCACGGGCGGCACGTCGAGGCCGTCCGCGACGAACTCGCC
CGCGTCCTCGCGCCGGTCGACCCGCGCGCCCCCGAGGTGCCGTTCTACTCGACGGTCACC
GGCGACCGCGTGGACGACGCCGCCTTCGACGGCGCCTACTGGTACACCAACCTCCGCCAG
ACCGTCCGCATGGAGGAGGCCACCCGCGCCCTCCTCGCCGCCGGACACCGCGTCTTCATC
GAGGTCAGCCCGCACCCGGTGCTCGCCGCCCCGATCCAGGAGACGCAGGAGGCCGTAGCG
GAGGCCACCGGCGGGTCCGCGGTGGTCCTCGGCTCGCTCCGCCGCGACGAGGGCGGCCCG
CGGCGCTTCCTGACGTCGCTCGCCGAGGCCCACACCCACGGCGCCCCGGTCGACTGGACC
ACCACCTTCGCCCGGTCCGCCTACCAGCCGGTGGACCTGCCGACCTACCCCTTCCAACGA
CAGGACTTCTGGCCCGAGGCCCGGCCCGCCACCCCGGCCGCCGGCGCCGACGCGTCCGAC
GCCGCGTTCTGGCAACTGGTCGAGAACCAGGACCTCGCCGCGCTCGCCGACGCGCTCGGC
GTCCCCGCCGACGACGAGCACACCGCGCTCGGCACCGTGCTGCCGGCCCTGTCCGCCTGG
CGCGCCAAGGCCCAGGCCCGCACCCGGATCGACGAACTCCGCTACCACGTCCAGTGGACC
CGGGTCGCCGAGCCCGCGGCGGCCCCCACCACCGGCCGGCTGCTGGTCGCCGTCCCGCCG
GACCACGCCGACGCCCCCTGGGTCGCCGCGGCGCTCGACGCCCTGGGCACCGACACCGTC
CGCTTCGAGGCCAAGGGCACCGACCGCGCGGGATGGGCCGCACAGATCGCCCAACTCGTC
GAGGACGGCGAGGAGTTCACCGGCGTGGTGTCGCTGCTGGCCGCCGCCGAGGATCTCCAC
CCGGACTTCGGCTCGGTACCGCTGGGGCTGGGGCAGACCCTCGTCCTCGTCCAGGCCCTC
GGCGACGCCGGCCTGACCGCGCCCCTGTGGTGCCTGACCCGCGGCGCCGTCGCCACCGGC
CGCGACGACGCCCTCGACAGCCCGACCCAGGGCGCCCTGTGGGGCCTCGGCCGGGTCGTG
GCCCTGGAACACCCCGACCGCTGGGGCGGCCTGATCGACCTGCCCGCCACCCTCGACGCC
CGCGCCGCGGCCCGCCTCACCGGCCTGCTCGCCGACCCCGCCGGTGAGGACCAACTCGCC
GTCCGCGCCACCGGCGTGCTCGCCCGCCGCATGGTGCACGCCGCGCCGTCCGCGCCCCGC
ACCGGGCGCCGCTGGCGGGGCCGCGGCACCTGCCTGATCACCGGCGGCACCGGCGGCATC
GGCGGCCGGGTCGCCCGCTGGATGGCCGAGCACGGCGCCGCCCACCTGGTCCTGACCAGC
CGGCGCGGCCCGGACGCACCCGGCGCCGCCGCACTCCGGGCCGAACTGGAGGCCCTGGGC
GCCCGCGTCACCCTCGCCGCCTGCGACGTCGCCGACCGCGACGCCCTGGCCGCCCTGCTG
GCCGACCTCCCCGCCGACCAGCCGCTCACCTCCGTCTTCCACTCCGCCGGCGTGGCCGAC
GGGGACGCCCGGGCAGCCGACCTGACCCTAGATCAGCTCGACGCGCTGCTGCGCGCCAAA
CTGACCGCCGCCCACCACCTGCACGAGCTGACCGCCCCCCTCGACCTCGACGCGTTCGTG
CTCTTCTCCTCCGGCGCCGCGGTCTGGGGCAGCGGCGGCCAGCCCGGCTACGCCGCCGCC
AACGCCTACCTCGACGCCCTCGCCGCCCACCGCAGGTCCCTCGACCTGCCCGGCGCGTCC
GTCGCCTGGGGCACCTGGGGCGAGGTCGGCATGGCCACCGTCCCCGAGGTCCACGAGCGA
CTGCACCGCCAAGGGGTCCGCGCCATGGAACCGGACCACGCGATCGGCGCGCTCCAGCAG
ATGCTGGAGGACGACGACACCACCCTCGCCGTGACCCTCATGGACTGGGAGGCGTTCGCA
CCGAGCTTCACCGCGACCCGACCCAGCGCCCTGTTCAGCACGGTGCCCGAAGCCGTCCGC
GCGGTGACCGGCGACCCGGGCACCACGGCCGGCGACGACGTGGACTCCGCGACCCCGCCG
CTCCGCCGCCACCTGGAGGAGCTGTCCGCCGCCGAGCGCGGCCGGGCCCTGGTCGAGGCG
GTCCGCGCCGAGGCGTCCGCGACCCTCGGCCACGACACCCCCGACGCCATCCCCGCCGGC
CGTGCCTTCCGCGACGTCGGCTTCGACTCGGTCACCGCCGTCGAACTGCGCAACCGGCTG
CGCACCGCCCTCGGCCTGCCGCTGCCGGCCGCGCTCGTCTTCGACCACCCCACCCCCACG
GCCCTCGCCGGCCACCTCGGCGCGCTGCTCTTCGGCACCGCCCCCGAGGACGCCGGCACC
GGCCGCCCCGACGACCCCGACGCCCGCATCCGCGAGGCGCTCGCCACCGTCCCCATCGGA
CGGCTGCGCAAGGCGGGCCTCCTCGACATGGTGCTGAAACTCGCCGACGGAGACGCGACC
GACGCCCCCGCCCCCGAGGCCGACGCCCCCTCGGAATCCCTCGACGACATGGACGCCGAA
GCCCTGCTGCGGCTGGCCACCGAGAACTCGGCGAACTGA
[1] KS41..412
[1] AT575..895
[1] methylmalonyl-CoA767..771
[1] KR1201..1381
[1] ACP1485..1555
[2] KS1579..1955
[2] AT2114..2436
[2] methylmalonyl-CoA not conserved YASHS(S->G)2305..2309
[2] KR2749..2929
[2] ACP3037..3107
[1] KS121..1236
[1] AT1723..2685
[1] methylmalonyl-CoA2299..2313
[1] KR3601..4143
[1] ACP4453..4665
[2] KS4735..5865
[2] AT6340..7308
[2] methylmalonyl-CoA not conserved YASHS(S->G)6913..6927
[2] KR8245..8787
[2] ACP9109..9321

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [570-698]  G3DSA:3.40.366.10 [767-882]  G3DSA:3.40.366.10 [2112-2237]  G3DSA:3.40.366.10 [2305-2426]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [2749-2913]  1.70000000000001e-60 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1513-1528]  PS00012 [3065-3080]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1478-1595]  1.99999636034521e-21 SSF47336 [3029-3124]  6.50000805230168e-22 SSF47336
SSF47336   ACP_like
 [1489-1554]  1.9e-08 PF00550 [3040-3106]  2.1e-10 PF00550
PF00550   PP-binding
 [1485-1555]  PS50075 [3037-3107]  PS50075
PS50075   ACP_DOMAIN
 [1485-1556]  4.9e-38 G3DSA:1.10.1200.10 [3036-3110]  4.9e-38 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1201-1380]  6.59999999999996e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [41-287]  2.39999999999997e-87 PF00109 [1579-1829]  7.5e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [295-412]  6.90000000000001e-49 PF02801 [1837-1955]  1.2e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [575-895]  7.5e-105 PF00698 [2114-2436]  6.40000000000004e-111 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [11-35]  6.60000000000002e-09 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [573-876]  3.49999466863949e-65 SSF52151 [2112-2414]  8.99992502689852e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [701-766]  4.90001027782405e-19 SSF55048 [2239-2304]  1.60000240695997e-19 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [44-299]  G3DSA:3.40.47.10 [300-466]  1.5e-129 G3DSA:3.40.47.10 [1581-1841]  G3DSA:3.40.47.10 [1842-2007]  1.5e-129 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [34-411]  1.09999184471405e-102 SSF53901 [1571-1953]  4.20003460493095e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1202-1387]  6.20000000000009e-68 G3DSA:3.40.50.720 [2749-2965]  2.09999999999996e-65 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [200-216]  PS00606 [1742-1758]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [577-875]  7.49999605851445e-122 SM00827 [2116-2417]  1.59998835313644e-129 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1486-1558]  1.10000150671642e-26 SM00823 [3038-3110]  3.30000526807186e-32 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [44-465]  SM00825 [1581-2007]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1201-1381]  1.49999648196323e-48 SM00822 [2749-2929]  1.20000117458134e-52 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit