close all open/close all

CDS information : Nysta_00150


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction76,403 / 109,693 / + [in whole cluster]
76,403 / 109,693 / + [in contig]
Location76403..109693 [in whole cluster]
76403..109693 [in contig]
TypeCDS
Length33,291 bp (11,096 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NysC
Gene
Gene (GenBank)nysC
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)

close this sectionPKS/NRPS Module

3 malonyl-CoA
4 malonyl-CoA
5 malonyl-CoA
6 malonyl-CoA
7 malonyl-CoA
8 malonyl-CoA
KS35..405
AT545..855
DH903..1067
KR1381..1561
ACP1662..1732
KS1757..2131
AT2289..2600
DH2649..2812
KR3124..3304
ACP3407..3477
KS3501..3875
AT4031..4343
DH4391..4555
ER4934..5238
KR5248..5428
ACP5524..5598
KS5623..5996
AT6165..6474
DH6523..6698
KR7038..7214
ACP7315..7385
KS7408..7782
AT7938..8251
DH8299..8464
KR8812..8992
ACP9116..9190
KS9214..9588
AT9757..10067
DH10118..10283
KR10657..10837
ACP10935..11009

close this sectionSequence

selected fasta
>polyketide synthase [NysC]
MSTNPDKYVEALRSSLKEIERLRRQNEQLVAAAVEPVAVVGIGCRFPGGVTSPEDLWELV
AEGRDVIGPFPQDRGWDLEKLAGGGEGGSLAQVGGFVEDAAGFDPGFFGISPREAVAMDP
QQRILLEITWEALERAGIDPSTLRGTPTGVFVGTTGQDYGEVIKASAEDVEVYSTTGHAA
SVISGRLSYTLGAEGPAVTVDTGCSSSLVALHWAVQALRGGECSMALAGGASIMATPGPF
VAFTAQSGLAADGRCKPFSDRADGTGWGEGAGMLVLMRLSDAQREGRPVLAVLRGSAINQ
DGASNGLTAPNGPSQQRVIRAALDSAHLTAADIDAVEAHGTGTTLGDPIEAQALLATYGQ
DRPRPLWLGSVKSNIGHTQAASGAAGVIKMIMALQRGVLPRSLHATEPTTDVDWTAGSVD
LLDETVAWPETGRARRAGVSSFGISGTNAHVILEQAPTAPEEPTTEPTVRPAVVPWALSA
RTAAALDAQRARLTGHLADTPDADPLDVGYALADGRATFEHRAVLLPDGTELAHGTAGEG
PCAVLFSGQGSQRPGMGRELHARFPVFAAAFDEITALLDTHLDRPLREVVWGTDADLLND
TGWAQPALFAVEVALYRLVASLGVTPDFVGGHSIGELAAAHVAGVLSLEDACTLVAARAR
LMQALPRGGAMLAIRATEDEVTPHLTDDVSIAAVNGPTSVVVAGTEEAVAAIGARFTAQD
RKTTRLRVSHAFHSPLMDPMLAEFRAVAAGLTYHEPRIPVLSNLTGTVAAVADLCSADYW
VRHVREAVRFADGVTALTDRGVTTLVELGPDGVLSAMAQESLPDGAAAVPLLRKDRPEEL
SAVTGLARAHVRGVTVRWAGLFDGTGARRADLPTYPFQHQRFWPTAARAAQDVTAAGLGA
ADHPLLGATVELADGAGYLFTSRLSVRTHPWLADHGVQGRALLPGTAFVELAVRAGDEAG
CDRVEELTLAAPLVLPERGGVQLQVRVGAPDAAGRRTLGIFSRVEDGFDLPWSQHATGVL
TAGAGAPDPTFDATVWPPSGAEPVDLTGAYERLAALGFQYGPAFQGLRAAWRRDTEVYAE
VALPDGADTDPAAFGLHPALLDAAQHAAAYADLGAISRGGLPFAWEGVSLAAAGATTVRA
RIAPAGEDTVTIAVYDAAGGTVLSVDSLVSREVPADAPGAAGTVHRDSLFHVEWTPLQGR
PGPAPATVAVLGPDPDALADTLRATGIRTTAPRDLAALADAEGPVPDLVVTTLTTTPGAP
VPDAAHATTAAVLALAQQWLADDRFADARLVLVTRGATDGTDPAAAAAGGLIRTARTENP
GRFALLDLAPDTGRPDPETLATALAASHDEPDLAVRGTDVHAARLARVPLATEPTTWNPD
GTVLITGGTGGLGAVLARHLVATHGVRHLLLASRRGPAADGADDLTAELTGLGATVHIAA
CDVADPAALADLLGTVPAGHPLTVVVHTAGVVDDGVLGSLTPQRLDTVLRPKADAAWHLH
EATRHLDLDAFVLFSSVAATLGSPGQANYAAGNAFLDALAARRAATGLPATSLAWGPWTQ
SVGMTSSLSDLDVERIARSGMPPLTLEQGTALFDAALAAGPAALAPVRLDLPVLRTQGDI
APLLRGLIRTPVRRTAAQVSQTADGLAQRLAGLDAAARREALLELVRTQIAQVLGHADAT
EVETGRQFQDLGFDSLTAVELRNALNTATGLRLPATMVFDYPTPHALADHLRDELLGTEA
ESTTAVPVPTRTAGTDDPIVIVGMACRYPGGIASPEDLWRLVSQGADATGPFPTNRGWDL
DNLYDPDPDRPGRTHVRAGGFLHDAGSFDADFFGMSPREAMATDSQQRLLLELSWEAVER
AGIDPASLRDSGTGVFAGVMYNDYGTTLTGDEYEAFRGNGSAPSVASGRVSYTLGLEGPA
VTVDTACSSSLVALHWAAQALRAGECSLALAGGVTVMSTPSTFVEFSRQRGLAPDGRSKA
FAEAADGVAWSEGVGMLVLERQSDAVRNGHEILAVVRGSAVNQDGASNGLTAPNGPSQQR
VIRQALASGGLSTADVDAVEAHGTGTTLGDPIEAQALLATYGRDRDPENPLLLGSIKSNI
GHTQAAAGVAGVIKMVMAMRHGVLPQTLHVDAPSSHVDWSVGAVELLTEQTAWPETGRAR
RAGVSSFGISGTNAHVVIEQSPTAVPATPASADRSVEEPPAVPWALSGKTPDALRDQAAR
LLAHVEAHPALRPVDISYSLIATRTAFDHRAVVLGTDRAEALRALTALAAGETDPAALTG
TVRTGRTAFLFSGQGSQRLGMGRVLYERFPAFAEALDTVLTALDAELGHPLRDIIWGEDA
QLVDRTGYTQPALFAIEVALFRLLEAWGITPDFVAGHSIGEIAAAHVAGVLSLGDACRLV
VARAVLMQSLPEGGAMIAVQATEDEVLPLLTDDVSIAAVNSPTSVVVSGYENATLAVARH
FADQGRRTTRLRVSHAFHSPLMAPMLDDFRAVVESLTFTAPTTPVVSNLTGELAPAEALC
SADYWVRHVREAVRFADGIRTLADRGVTTFVELGPDSVLSAMAQESAPEGAGTIPLLRRD
RPEEQAVLAALCHLQVLGVEADWSATFRGLDPVRVDLPTYAFQHRWFWPAARPARPDDVR
AAGLGAAEHPLLGAAVQLPDDDGALFTGRLSLRTHPWLADHTVLGTVLLPGTALVELAVR
AGDETGSGHLEELTLAAPLTLPEDGATLLQVRVGSADDTGRRTVTVHARPDDTADRTWTL
HATGVLATTPPAAAAFDTTVWPPADAEPLTTDDCYAHFTTHRFAYGPAFQGLRAAWRAGD
VLYAEVALPESATDEAAAFGLHPALLDAGLHAALLADDRDTGLPFSWEGVTLHASGATAL
RVRLAPNGPNGLSVTAADPAGNPVATVTRLLARPLDAEQLTIHSALTRDALFHLDWTPVP
LPDTANSAPPALLGPDTAVLADALGDPAVARHATLDDLLAGDTTPPATVLVPLGAPLDGD
TAQHAHALTRSALTLVQQWLATDRLADSRLVFVTHGAVATDDAPPTDLAAAAVWGLIRSA
QTENPGTFTLLDLDTEPDSTTALSRALTLDEPQLLLRAGRARAARLTRTPAPTTTTHTPW
SADGTVLVTGGTGGLGGLVARHLVRSCGVRHLLLTSRSGVGAAGAAGLVAELESLGARVV
VAACDVGDGSAVAELVAGVSESYPLSAVVHAAGVLDDGVVGSLTPERLAAVLRPKVDGAW
NLHEATRGLDLDAFVVFSSVAGVFGGAGQANYAAGNAFLDALMVHRVAGGLPGVSLAWGA
WDQGVGMTAGLTERDVRRAAESGMPLLTVDQGVALFDAALATGSAALVPVRLDLAALRTR
GDIAPLLRGLVRAPLRRTAATGLATGADTGLVQRLGRLDHAQRHEALLDMVRSSAALVLG
HADGNAIDAERAFRDLGFDSLTAVELRNRLRTATGLHLSATMVFDHPTLSALAEHLRDEL
FGAVESEVRVPVQALPPTADDPIVVVGMACRFPGGVTSPEDLWRLVDDGTDAITTFPTNR
GWDLDNLYDPDPEHFGTSYTRSGGFLHEAGEFDPAFFGMSPREALATDSQQRLLLESSWE
AIERAGIDPLTLRGSATGVFAGVMYSDYGSILGGKEFEGFQGQGSAGSVASGRVSYALGF
EGPAVTVDTACSSSLVALHWAAQALRAGECSLALAGGVTVMSTPSTFVEFSRQRGLAPDG
RSKAFAEAADGVGWSEGVGILVLERQSDAVRNGHEILAVIRGSAVNQDGASNGLTAPNGP
SQQRVIRQALASGGLSTADVDAVEAHGTGTTLGDPIEAQALLATYGRDRDPENPLWLGSL
KSNIGHTQAAAGVAGVIKMVMAMRHGVLPQTLHVDAPSSHVDWSVGAVELLTEQTAWPET
GRVRRAGVSSFGISGTNAHVIVEQPALVESPAAEPSGREPGVVPLPLSGKSPEALRDQAA
RLLAGLAERPALRPLDLGYSLATTRSAFDHRAVVLATDRADAVRALTALAAADADLSAVV
GDTRTGRHAVLFSGQGSQRLGMGRELYERFPVFAEALDVAIDHLDAALPAQASLREVMWG
DDVELLDETGWTQPALFAVEVALFRLVESWGVRPDFVAGHSIGEIAAAHVVGVFSLEDAC
RLVAARATLMQALPTGGAMIAIQAAEDEVTQHLTDDVSIAAVNGPTSVVVSGAESAARTV
ADRLAENGRKTTRLRVSHAFHSPLMDPMLAEFRAVAEGLSYATPTLPVVSNLTGRLATAD
DLCSAEYWARHVREAVRFADGVSTLENEGVTTFLELGPDGVLSAMAQQSLTGDAATVPAL
RKDRDEETSALTALAHLHTAGLRVDWAAFFAGSGATRVDLPTYAFQHATYWPTGTLPTAH
AAAVGLTAAEHPLLNGSVELAEGEGVLFTGRLSLQSHPWLADHAVMGQVLLPGTALLELA
FRAGDEAGCDRVEELTLAAPLVLPERGAVQTQVRVGVADDTGRRTVTVHSRPEHATDVSW
TQHATGTLTMGSAPADTGFDATAWPPADAEPLATDDCYARFTTLGFAYGPVFQGLRAAWR
AGDVLYAEVALAESTGDEATAFGLHPALLDAALHASLVAHEGEESNGGLPFSWEGATLYA
TGATALRVRLTPTGTDGRSVAIAVADTAGRPVAAIDNLVSRRVSGDQLTGAAGLARDALF
TLDWNPVPENLVPENPVPENTGGGHAQDQDGRPAAATVALVGADGTAIAADLTAAGIHTT
LHPDLTTLATTDADVPKTVLIPLTGTGTGTGTGTESTDGIGTGAAESDASAPSPAEVAHT
LSTAALALVQEWTAQERFAGSRLAFVTTGATAAGGTDVMDVAAAAVWGLVRSAQSEAPDT
FVLIDRDPGPAGTHDRTAAAERGQLLLRALHTDEPQLALRDGGVLAARLARFDTAAALTP
PADRAWRLDSTAKGSLNGLALTPYPAALAPLTGHEVRVEVRAAGLNFRDVLNALGMYPGD
DVGSFGSEAAGVVVEVGPEVTGLAPGDQVMGMITGSFGSLAVDDARRLARLPEDWSWETG
ASVPLVFLTAYYALKELGGLRAGEKVLVHAGAGGVGMAAIQIARHVGAEVFATASEGKWD
VLRSLGVADDHIASSRTLDFEAAFAEVAGDRGLDVVLNSLAGDFVDASMRLLGDGGRFLE
MGKTDIRAADSVPDGLSYQSFDLAWVVPETIGTMLAELMDLFRTGALRPLPVRTWDVRHA
KDAFRFMSMAKHIGKIVLTLPRSWKPEGTVLVTGGTGGLGGLVARHLVRSCGVRHLLLTS
RSGVGAAGAAGLVAELESLGARVVVAACDVGDGSAVAELVAGVSESYPLSAVVHAAGVLD
DGVVGSLTPERLAAVLRPKVDGAWNLHEATRGLDLDAFVVFSSVAGVFGGAGQANYAAGN
AFLDALMVHRVAGGLPGVSLAWGAWDQGVGMTAGLTERDVRRAAESGMPLLTVDQGVALF
DAALATGSAALVPVRLDLAALRTRGDIAPLLRGLVKAPIRRAAATTPGDTGLAEQLTRLQ
RAERRDTLLALVRDQAAMVLGHTSGDGVDPSRAFRDLGFDSLTAVELRNRIGAATGLRLP
ATAVFDYPTADALAAHLLTELLGPDAESDPDEPGDPTAGPTDDPIVIIGMSCRFPGDIGS
PEDLWRLLGDGADVVTDFPTNRGWDLDNLYDPDPAHAGTSYARTGGFLHDAADFDADFFG
MSPREAMATDSQQRLLLESSWEAIERAGIDPLTLRDSRTGVFAGVMYSGYGTRLDGAEFE
GFQGQGSALSVASGRVSYTFGFEGPAMTVDTACSSSLVALHLAAQALRGGECTLALAGGV
TVMSIPDTFIEFSRQRGLAPDGRSKPFSESADGVGWSEGVGMLLLERQSDAVRNGHQILA
VVRGSAVNQDGASNGLTAPNGPSQQRVIRQALASGGLSTADVDAVEAHGTGTTLGDPIEA
QALLATYGRDRDPENPLLLGSIKSNLGHTQAAAGVAGVIKMVMAMRHGVLPRSLNITEPS
SHVDWSAGAVELLTEQTAWPETGRARRAGISSFGISGTNAHVILEQPEAARHSAPEEADT
AEAAAKAPATAHLPVMPWALSGKTPEALRAQAARLLAHLQQRPELAPADIALSLATQRSQ
FTHRAVVLSTDRDEATRALSALATTAASDPSALTGTVTMGRCAVLFSGQGSQRLGMGREL
YERFPVFAEALDVVIDHLDAALPAQAGLREVMWGDDVELLNETGWTQPALFAIEVALFRL
VESWGVRPDFVAGHSIGEIAAAHVVGVFSLEDACRLVAARATLMQALPAGGAMIAVQATE
DEVIPHLTDEVAIAAVNGPTSVVISGAEEATQTVAQHFADQGRRTTALRVSHAFHSPLMM
LAEFRAVAEGLSYATPTLPVVSNLTGQVATADELCSAEYWVRHVREAVRFADGVTALEAE
GVRTFLELGPDGVLAAMARETVADDTVTVPVLRRNMPEERTLLTALGRLHTTGTPIDWAA
LLAPTGARPVDLPTYAFQHRPFWPSGPRDTADAAAVGIAGASHPLLNGIVELADEEGLLF
TGRLSLQSHPWLADHAVMGQVLLPGTALLELALRAGDEVGCDHVEELTLAAPLVLPERGA
VQTQVRVGVADTTGRRTVTIHSRPARATTTDSDTHTGTDTPWTQHATGVLVAGLPATATV
PFDATVWPPAHAEPVDLADFYASRAGEGFGYGPAFQGLRAAWRRDGEVFADVALPEAGRT
EAEAYGLHPALLDAGLHAAWLVAPDGEPTRTGSVPFSWRGVFLAASGASSVRVRLGRDSD
GTLSLAIADTTGAPVASVQALSMRTVSVTALSATAGLARDALFRLDWASAPEPACQPDDT
VTVIPAVAVVGTETSELTSELTAALRAAGADVDVRTTLSTDEPAPALIALPLVASDQTGT
AEAAPVPAAVHDLTRRALALVQTRLQEQHFADTKFVFVTRGATVGRDVAAAAVWGLVRSA
QSENPGCFALVDLDPDGAVGAAALVAALVSGEPQLAVRGDVLRVARLVRRPLTEVGAGAD
GTGDGVGGGSGVSFSGEGAVLVTGGTGGLGAVLARHLVAEYGVRDLLLVSRSGERAVGAG
ELVAELAGVGARVRVVACDVTDRAAVVELVGGHAVSAVVHAAGVLDDGMVGALTGERLSA
VLRPKVDAVWHLHEATRGLDLDAFVVFSSLAGVFGSPGQANYAAANAFLDALMTRRRAEG
LPGLSLAWGPWSLTDGTSGMLADAEADRLTRSGVPPLTAEQGLALFDAALATGDATCVPV
RLDLSALRAQGEVPPLLRSLIRGRSRRAAAAESATATGLRERLVGLNPVERQEVLLDLVR
GQVALVLGHADADDVHPARAFRELGFDSLTSVELRNRLNTVTGLRLPATMVFDYPTVEVL
VSYVLDELLGTDAEVATVQPAAVAVADDPIVIVGMACRYPGGVASPDDLWRLVTDGVDAV
SPFPTNRGWDVESLYHPDPDHLGTSYTRSGGFLHEAGEFDPGFFGMSPREALATDSQQRL
LLESSWEAIERAGIDPVSLRGSRTGVFAGVMYSDYSAMLASPEFEGFQGSGSSPSLASGR
VAYTLGLEGPAVTVDTACSSSLVAMHWAMQALRSGECGLALAGGVTVMSTPAVFVDFARQ
RGLSPDGRCKAFADAADGVGWSEGVGVLVLERQSDAVRNGHEILAVVRGSAVNQDGASNG
LTAPNGPSQQRVIRQALASGGLTAGDVDVVEAHGTGTTLGDPIEAQALLATYGRDREPER
PLLLGSVKSNLGHTQAAAGVAGVIKMVLAMRHGVVPRTLHVDAPSSHVDWSEGAVELLSE
QAAWPETGRVRRAGVSSFGISGTNAHVILERPEAARRPVMETNTVEPSTVPWVLSGKTPE
ALRAQAAKLLSSIEERPELRLVDVGMSLVTGRSTFEHRAVVLAADRADAARALSAIAADE
ADAAAATGRVGAGRHAVLFSGQGAQRLGMGRELYERFPVFAEALDVVVDHLDAALPAQAG
LREVMWGDDAELLNETGWTQPALFAIEVALFRLVESWGVRPDFVAGHSIGEIAAAHVAGV
FSLEDACRLVAARATLMQALPAGGAMIAVQATEDEVTPHLTDDVAIAAINGPNALVVSGV
EDAAVEIGARFAAEGRRTTRLHVSHAFHSPLMDPMLAEFRVVAEGLSYAAPSLPVVSNLT
GQVATADELCSAEYWVRHVREAVRFADGVTALEAEGVRTFLELGPDGVLAAMAGASLTES
SLAVPLLRKDRPEEPAALAALAQLHIAGARVDWPVLFAGVGAGRVELPTYAFQRGWFWPV
GRVGVGGDVGAVGLGSAGHPLLGAAVELAAGAGVVLTGRLSLSSHGWLADHAVMGRVFVP
GTALLEMVMRAGDEVGCGRVEELTLAAPLVLPERGGVRVQVAVDAPDAAGRRGVGVYSCP
DGVGQAVWSQHAVGVLASGVADQVGGFGDGGVWPPQGAVSVDAEGCYELFADAGFGYGPV
FQGLRAVWRRGEELFAEVALSDEVAESADTATGFGLHPALLDASLHASLLSSLEGQSADG
GPALPFAWEGVSLFASGATALRVRLAPAGEHAVSVTAVDPTGAPVISIDALRTRRLTLDE
VNASHTQLSDALFGVQWTTVPSTPAADHPSVAIIGTDHLGLAEALSSSSAGATTTTTAAA
YESLDALIAAGPEVSVPDVTLIGLTTEDAIAQYVNDHDATVAGQGTIGAGAAAVDAARRL
TAEALRTIQAWLADERLAARRLVFVTRGAADGQDVAAAAVQGLVRSAQTENPGTFGLLDL
DGTEASTAVLGEALTSDEPQLLLRDGHLHAARLTRLASPADTAVPTEWNADGTVLITGGT
GGLGAQFARHLVDRYGVRNLLLVSRRGPDAPGTTELVAELTAHGAEVAVQACDVADGDAV
AALVAGVPDEHPLRAVVHTAGVLDDGVIGSLTEERLATVLRPKADAAWHLHEATRGLDLD
AFVVFSSVAGVFGGAGQANYAAANAFLDALMAQRRAAGLPGLSLAWGPWDQTGGMTGMLS
DAEADRLARSGIPPLSAEQGLALFDAALALAGTSTPDRAAGSAAASTSGTGDTIAIPAAA
LVAPVRLDLAALAAQGEVPAILRGLVRTRTRRTAAGGSVTVAGLVNRLSGLTADERRQEL
LELVRTQAALVLGHADPASVDSTAQFRDLGFDSLTAVELRNRLSTATGLRLTATLVFDYP
NTDALAEHLRDELFGAVESEVRVPVQALPPTADDPIVVVGMACRFPGGVTSPEDLWRLVD
AGTDAITTFPTNRGWDLESLYDPDPAHLGTSYTRSGGFLHEAGEFDPAFFGMSPREALAT
DSQQRLLLESSWEAIERAGIDPLTLRGSATGVFAGVMYSDYGSILGGKEFEGFQGQGSAG
SVASGRVSYTLGFEGPAVTVDTACSSSLVALHLAAQALRAGECTLALAGGVTVMSTPGTF
VEFSRQRGLAPDGRSKAFAEAADGVGWSEGVGILVLERQSDAVRNGHEILAVIRGSAVNQ
DGASNGLTAPNGPSQQRVIRQALASGGLSTADVDAVEAHGTGTTLGDPIEAQALLATYGR
DRDPENPLLLGSIKSNLGHTQAAAGVAGVIKMVMAMRHGVLPQTLHVDAPSSHVDWSVGA
VELLTEQTVWPETGRVRRAGVSSFGISGTNAHVILEQPEAVQRLAPGAAETVEPVAIKPS
AEPSLVPWALSGKSPEALRAQAARLRDFLAERPEPRSIDIGHSLAVTRSQFDHRAIVLVD
DAKAPADSLAALAALASGVADPAVVSDAVSTGGSAVLFTGQGAQRLGMGRELYGRFPVFA
EALDVVVDHLDAALPAQAGLREVMWGDDVELLNETGWTQPALFAVEVALFRLVERWGVRP
DFVAGHSIGEIAAAHVAGVFSLEDACRLVAARATLMQALPTGGAMIAVQATEDEVTPHLT
DEVAIAAVNGPTSVVISGAEEATQTVAQHFADQGRRTTALRVSHAFHSPLMDPMLAEFRA
VAEGLSYATPSLPVVSNLTGWLATADELCSAEYWVRHVREAVRFADGITTLEAEGVRTFL
ELGPDGILSALAQQSLAGEAVTVPVLRKDRGEESTALTARAHLHTRGLIEDWQDFFAGVG
AGRVELPTYAFQRGWFWPVGRVGVGGDVGAVGLGSAGHPLLGAAVELAAGAGVVLTGRLS
LSSHGWLADHAVMGRVFAPGTALLEMVMRAGDEVGCGRVEELTLAAPLVLPERGGVRVQV
AVDAPDAAGRRGVGVYSCPDGVGQAVWSQHAVGVLASGAADQVGGFGDGGVWPPQGAVSV
DAEGCYELFADAGFGYGPVFQGLRAVWRRGEELFAEVALSDEVAESADTATGFGLHPALL
DASLHASLLSSLEGQSADGGPALPFAWEGVSLFASGATALRVRLAPAGEHAVSVTAVDPT
GAPVISIDALRTRRLTLDEVNASHTQLSDALFGVQWTTVPSTPAADHPSVAIIGTDPFGL
ADGLSDALPLVEERGDLAALAASEHPVPDLVLVPVAGTRRTGVPADAEGHTDAGTSDMLR
SVREATAQVLEQIQQWLADDRFEAARLVFVTRGAVSVGEGGIADLAASAVWGLVRSAQSE
NPGCFGLLDLDLDLALDSDLAPEVDIERDRDRDPVGGTVQPALAAALHATADEPQLALRG
GTVQAARLTRIPAPQTDRAETDPAETDRPEIDTRRPGTVLITGGTGGLGGLLARHLVAER
GVRSLVLASRSGLAAEGAEKLVADLEALGAVVAVQTCDVADGDAVAALVAGVSDEYPLTA
VVHTAGVLDDGVIGSLTEERLATVLRPKADAAWHLHEATRDLDLDAFVVFSSLAGVLGGA
GQANYAAANTFLDALMAQRRAAGLPGVSLAWGPWDRAGGMTGTLSDAEADRLARSGVPPI
SAEQGLALYDAATAGERPLVVPVRLDLAALRGLGDVPALLRGLVRTPARRTAAAGAAPSA
DVLTRQLAGLGGAEQEEVLLRLVRGQAAVVLGHADGSAIGAGRQFQELGFDSLTAVEFRN
RLNAATGLRLPATLLFDYPTPADVVGHLRGRLGTGEVSGAGSVLAALDNLEAVIAGLSLD
DAGEHQLVAGRLEVLRAKWADMRSAEGAVDGGADVDIEEASDDDMFALLDDELGLN
selected fasta
>polyketide synthase [NysC]
ATGAGCACGAACCCCGACAAGTACGTCGAGGCACTCCGGTCGTCCCTGAAGGAGATCGAG
CGGCTGCGCCGGCAGAACGAACAGCTGGTGGCGGCGGCGGTCGAGCCCGTCGCGGTCGTC
GGCATCGGCTGCCGCTTCCCCGGCGGCGTCACCTCCCCCGAGGACCTGTGGGAGCTGGTC
GCCGAGGGGCGCGACGTCATCGGGCCGTTCCCGCAGGACCGCGGCTGGGACCTGGAGAAG
TTGGCCGGCGGCGGCGAGGGCGGCAGCCTCGCGCAGGTCGGCGGCTTCGTCGAGGACGCC
GCCGGCTTCGACCCCGGCTTCTTCGGCATCTCCCCGCGCGAAGCGGTCGCCATGGACCCG
CAGCAGCGCATCCTGCTGGAGATCACCTGGGAAGCCCTGGAACGCGCCGGCATCGACCCG
TCCACCCTGCGCGGTACCCCCACCGGCGTCTTCGTCGGCACCACCGGCCAGGACTACGGC
GAGGTCATCAAGGCGTCCGCCGAGGACGTCGAGGTCTACTCGACCACCGGCCACGCCGCC
AGCGTCATCTCCGGCCGGCTCTCCTACACCCTCGGCGCCGAGGGCCCGGCCGTCACCGTC
GACACCGGCTGCTCCTCGTCCCTGGTCGCCCTGCACTGGGCCGTCCAGGCGCTGCGCGGC
GGCGAGTGCTCCATGGCCCTGGCCGGCGGCGCGTCCATCATGGCCACCCCGGGCCCGTTC
GTCGCCTTCACCGCGCAGAGCGGCCTGGCCGCCGACGGCCGCTGCAAGCCCTTCTCCGAC
CGGGCCGACGGCACCGGCTGGGGCGAGGGCGCCGGCATGCTGGTCCTGATGCGGCTCTCC
GACGCCCAGCGCGAGGGCCGCCCGGTCCTCGCCGTGCTGCGCGGCTCCGCCATCAACCAG
GACGGCGCCTCCAACGGCCTGACCGCTCCCAACGGCCCCTCCCAGCAGCGCGTCATCCGC
GCCGCGCTGGACAGCGCCCACCTCACCGCCGCCGACATCGACGCCGTCGAGGCCCACGGC
ACCGGCACCACCCTCGGCGACCCGATCGAGGCCCAGGCGCTCCTGGCGACCTACGGACAG
GACCGGCCGCGGCCCCTGTGGCTCGGCTCGGTGAAGTCCAACATCGGCCACACCCAGGCC
GCCTCCGGTGCCGCCGGCGTGATCAAAATGATCATGGCGTTGCAGCGCGGCGTGCTGCCG
CGCAGCCTGCACGCCACCGAACCCACCACGGACGTCGACTGGACCGCCGGCTCCGTCGAC
CTCCTCGACGAGACGGTCGCCTGGCCCGAGACCGGACGCGCCCGCCGCGCCGGCGTCTCC
TCCTTCGGCATCAGCGGCACCAACGCCCACGTCATCCTCGAACAGGCCCCCACCGCCCCC
GAAGAGCCCACCACCGAACCCACCGTCCGCCCCGCCGTCGTCCCGTGGGCGCTCTCCGCC
CGCACCGCCGCCGCCCTCGACGCCCAGCGCGCCCGCCTCACCGGCCACCTCGCCGACACC
CCCGACGCCGACCCCCTCGACGTCGGCTACGCGCTCGCCGACGGACGCGCCACCTTCGAA
CACCGCGCCGTCCTGCTCCCCGACGGCACCGAACTCGCCCACGGAACCGCCGGCGAAGGC
CCCTGCGCCGTCCTCTTCTCCGGCCAGGGCTCCCAGCGCCCGGGCATGGGACGCGAACTC
CACGCCCGCTTCCCGGTGTTCGCCGCGGCCTTCGACGAGATCACAGCGCTCCTCGACACC
CACCTCGACCGCCCGCTGCGCGAGGTCGTCTGGGGCACCGACGCCGACCTGCTGAACGAC
ACCGGCTGGGCCCAACCCGCCCTGTTCGCCGTCGAGGTCGCCCTCTACCGCCTGGTCGCG
TCCCTCGGCGTCACCCCCGACTTCGTCGGCGGCCACTCCATCGGCGAGCTCGCCGCCGCG
CACGTCGCCGGGGTCCTCTCCCTCGAAGACGCCTGCACCCTCGTCGCCGCCCGCGCCCGC
CTCATGCAGGCCCTGCCGCGCGGCGGCGCGATGCTCGCGATCCGCGCCACCGAGGACGAG
GTCACCCCCCACCTCACCGACGACGTCTCGATCGCCGCCGTCAACGGGCCCACCTCCGTC
GTCGTCGCCGGCACCGAGGAAGCCGTCGCCGCGATCGGGGCGCGCTTCACCGCCCAGGAC
CGCAAGACCACCCGGCTGCGGGTCAGCCACGCCTTCCACTCGCCGCTCATGGACCCGATG
CTGGCGGAATTCCGCGCCGTCGCCGCGGGCCTGACCTACCACGAGCCGCGCATCCCGGTC
CTCTCCAACCTCACCGGCACCGTCGCCGCCGTCGCCGACCTGTGCTCCGCCGACTACTGG
GTCCGCCACGTCCGCGAGGCGGTCCGCTTCGCCGACGGCGTCACCGCCCTCACCGACCGC
GGCGTGACCACGCTCGTCGAACTCGGCCCGGACGGCGTGCTGTCCGCCATGGCCCAGGAA
TCCCTGCCGGACGGCGCCGCCGCCGTGCCGCTGCTGCGCAAGGACCGCCCCGAGGAGCTC
TCCGCCGTCACCGGCCTGGCCCGCGCCCACGTCCGCGGCGTCACGGTCCGCTGGGCCGGC
CTCTTCGACGGCACCGGCGCGCGCCGCGCCGACCTGCCCACCTACCCCTTCCAGCACCAG
CGGTTCTGGCCGACCGCGGCCCGCGCCGCCCAGGACGTCACCGCCGCGGGACTGGGCGCC
GCCGACCACCCGCTGCTCGGCGCCACCGTCGAACTCGCCGACGGGGCCGGCTACTTGTTC
ACCAGCCGGCTCTCCGTCCGGACCCACCCCTGGCTCGCCGACCACGGGGTCCAGGGCCGG
GCCCTGCTGCCCGGCACCGCCTTCGTCGAACTGGCCGTCCGCGCCGGCGACGAGGCCGGC
TGCGACCGCGTCGAGGAACTGACCCTGGCCGCCCCCCTGGTGCTGCCCGAGCGCGGCGGC
GTCCAACTCCAGGTCCGCGTCGGCGCCCCCGACGCCGCCGGCCGCCGCACCCTCGGCATC
TTCTCCCGCGTCGAGGACGGCTTCGACCTGCCCTGGTCGCAACACGCCACCGGCGTCCTG
ACCGCCGGCGCCGGCGCCCCCGACCCCACCTTCGACGCCACCGTCTGGCCCCCCAGCGGC
GCCGAACCCGTCGACCTCACCGGCGCGTACGAGCGCCTGGCCGCACTCGGCTTCCAGTAC
GGCCCCGCCTTCCAGGGCCTGCGCGCCGCCTGGCGCCGCGACACCGAGGTCTACGCCGAA
GTGGCCCTGCCCGACGGCGCGGACACCGACCCCGCCGCCTTCGGACTGCACCCGGCCCTG
CTGGACGCCGCACAACACGCCGCCGCCTACGCCGACCTCGGCGCCATCAGCCGCGGCGGC
CTGCCGTTCGCCTGGGAAGGCGTCTCGCTCGCCGCCGCCGGCGCCACCACCGTCCGCGCC
CGGATCGCCCCGGCCGGCGAGGACACCGTCACCATCGCCGTCTACGACGCCGCCGGCGGC
ACCGTGCTGTCCGTCGACTCCCTGGTCTCCCGCGAGGTCCCCGCCGACGCACCCGGCGCC
GCCGGCACCGTCCACCGCGACTCCCTCTTCCACGTCGAGTGGACCCCGCTCCAGGGCCGC
CCGGGCCCCGCACCGGCCACCGTCGCCGTCCTCGGCCCCGACCCGGACGCCCTCGCCGAC
ACCCTCCGCGCCACCGGCATCCGGACCACCGCCCCCCGCGACCTGGCCGCCCTCGCCGAC
GCCGAAGGGCCCGTCCCCGACCTGGTCGTCACCACCCTCACCACCACCCCGGGCGCCCCC
GTCCCCGACGCCGCGCACGCCACCACCGCCGCCGTCCTCGCCCTCGCCCAACAGTGGCTC
GCCGACGACCGCTTCGCCGACGCCCGCCTGGTCCTCGTCACCCGCGGCGCCACCGACGGC
ACCGACCCCGCCGCCGCGGCCGCCGGCGGCCTGATCCGCACCGCCCGCACCGAGAACCCC
GGCCGTTTCGCCCTCCTCGACCTCGCCCCCGACACCGGCCGGCCCGACCCCGAGACCCTG
GCCACCGCCCTGGCCGCCAGCCACGACGAGCCCGACCTCGCCGTCCGCGGCACCGACGTG
CACGCCGCCCGCCTGGCCCGTGTCCCGCTCGCCACCGAACCCACCACCTGGAACCCGGAC
GGCACCGTCCTGATCACCGGCGGCACCGGCGGCCTGGGCGCGGTCCTCGCCCGCCACCTG
GTCGCCACCCACGGCGTCCGCCACCTGCTGCTCGCCAGCCGCCGCGGCCCGGCCGCCGAC
GGCGCCGACGACCTGACGGCCGAACTCACCGGGCTCGGCGCCACCGTCCACATCGCCGCC
TGCGACGTCGCCGACCCGGCCGCCCTCGCCGACCTGCTCGGCACCGTCCCGGCCGGGCAC
CCGCTCACCGTCGTCGTCCACACCGCCGGCGTCGTCGACGACGGCGTCCTCGGCTCCCTC
ACCCCGCAGCGCCTGGACACCGTCCTGCGGCCCAAGGCCGACGCCGCCTGGCACCTGCAC
GAGGCGACCCGCCACCTCGACCTGGACGCCTTCGTCCTCTTCTCGTCCGTCGCCGCCACC
CTCGGCAGCCCCGGACAGGCCAACTACGCCGCCGGCAACGCCTTCCTGGACGCCCTCGCC
GCCCGGCGCGCCGCCACCGGCCTGCCCGCCACCTCCCTCGCCTGGGGCCCGTGGACCCAG
AGCGTCGGCATGACAAGCAGCCTGTCCGACCTCGACGTCGAGCGCATCGCCCGCTCCGGC
ATGCCCCCGCTGACCCTGGAACAGGGCACCGCCCTCTTCGACGCGGCCCTGGCCGCCGGG
CCCGCCGCCCTCGCCCCGGTCCGCCTCGACCTGCCCGTCCTGCGCACCCAGGGCGACATC
GCCCCGCTGCTGCGCGGCCTGATCCGCACCCCCGTGCGGCGCACCGCCGCCCAGGTCTCG
CAGACCGCCGACGGCCTCGCCCAGCGGCTCGCCGGCCTCGACGCCGCCGCCCGCCGGGAA
GCCCTCCTGGAACTCGTCCGCACCCAGATCGCCCAGGTCCTCGGCCACGCGGACGCCACC
GAGGTGGAGACCGGCCGCCAGTTCCAGGACCTCGGCTTCGACTCCCTCACCGCCGTCGAA
CTCCGCAACGCCCTGAACACCGCCACCGGCCTGCGGCTGCCCGCCACCATGGTGTTCGAC
TACCCGACACCACACGCCCTCGCCGACCACCTGCGCGACGAACTCCTGGGCACCGAGGCC
GAGTCGACCACCGCCGTCCCCGTGCCGACCCGTACCGCCGGCACCGACGACCCGATCGTC
ATCGTCGGCATGGCCTGCCGCTACCCCGGCGGCATCGCCTCACCCGAGGACCTCTGGCGC
CTGGTCAGCCAGGGCGCCGACGCCACTGGCCCGTTCCCCACCAACCGCGGCTGGGACCTG
GACAACCTCTACGACCCCGACCCCGACCGCCCGGGCCGCACCCACGTCCGCGCCGGCGGC
TTCCTGCACGACGCCGGCTCCTTCGACGCCGACTTCTTCGGGATGAGCCCGCGCGAGGCG
ATGGCCACCGACTCCCAGCAGCGCCTGCTGCTCGAACTCTCCTGGGAAGCCGTCGAACGC
GCCGGCATCGACCCCGCCTCACTGCGCGACTCCGGCACCGGCGTCTTCGCCGGCGTCATG
TACAACGACTACGGCACCACCCTGACCGGCGACGAGTACGAGGCGTTCCGCGGCAACGGC
AGCGCCCCGAGCGTCGCCTCCGGCCGCGTCTCCTACACCCTCGGCCTGGAAGGCCCGGCC
GTCACGGTGGACACCGCCTGCTCTTCCTCTCTGGTCGCCCTGCACTGGGCGGCGCAGGCG
TTGCGGGCGGGGGAGTGCTCGTTGGCGTTGGCCGGTGGTGTGACGGTGATGTCGACGCCG
AGCACGTTCGTGGAGTTCTCGCGGCAGCGGGGTCTGGCGCCTGATGGTCGTTCGAAGGCG
TTCGCCGAGGCCGCGGACGGCGTGGCCTGGTCCGAGGGCGTCGGCATGCTGGTCCTGGAG
CGGCAGTCGGACGCGGTGCGCAACGGTCACGAGATCCTGGCCGTGGTGCGCGGCTCGGCG
GTCAACCAGGACGGTGCGTCCAACGGTCTGACCGCGCCCAACGGCCCGTCCCAGCAGCGG
GTGATCCGTCAGGCGTTGGCCAGTGGCGGCCTGTCCACGGCCGACGTGGACGCCGTTGAG
GCGCACGGCACGGGTACGACGCTCGGTGACCCGATCGAGGCCCAGGCGCTCCTGGCCACC
TACGGTCGCGACCGCGACCCCGAGAACCCGCTGCTGCTCGGCTCGATCAAGTCCAACATC
GGTCACACCCAGGCAGCGGCCGGTGTCGCCGGTGTCATCAAGATGGTCATGGCGATGCGG
CACGGCGTGCTGCCGCAGACCCTGCATGTCGACGCGCCGTCCTCGCACGTCGATTGGAGC
GTCGGCGCCGTCGAACTGCTCACCGAGCAGACCGCCTGGCCGGAGACCGGCCGGGCCCGT
CGCGCCGGTGTCTCCTCCTTCGGCATCAGCGGCACCAACGCCCACGTCGTCATCGAGCAG
TCCCCGACCGCCGTCCCCGCCACGCCCGCGTCCGCCGACCGGTCCGTCGAGGAACCGCCG
GCCGTCCCCTGGGCCCTGTCCGGCAAGACCCCCGACGCCCTCCGCGACCAGGCCGCCCGC
CTCCTCGCCCACGTCGAGGCCCACCCCGCACTGCGCCCCGTCGACATCAGCTACTCCCTG
ATCGCCACCCGCACCGCCTTCGACCACCGCGCCGTCGTCCTCGGCACCGACCGCGCCGAG
GCCCTGCGCGCCCTCACCGCCCTCGCCGCCGGCGAGACCGACCCGGCCGCCCTCACCGGC
ACCGTCCGCACCGGCCGCACCGCCTTCCTCTTCTCCGGCCAGGGCTCCCAACGGCTCGGC
ATGGGCCGCGTCCTCTACGAGCGGTTCCCCGCCTTCGCCGAAGCCCTCGACACCGTCCTC
ACCGCCCTCGACGCGGAACTCGGCCACCCCCTCCGCGACATCATCTGGGGCGAGGACGCT
CAACTCGTCGACCGGACCGGCTACACCCAACCCGCCCTGTTCGCCATCGAGGTGGCACTC
TTCCGCCTCCTGGAAGCCTGGGGCATCACACCGGACTTCGTGGCCGGCCACTCCATCGGC
GAGATCGCCGCCGCACACGTCGCCGGCGTGCTCTCCCTCGGCGACGCCTGCCGCCTCGTC
GTGGCCCGCGCCGTGCTGATGCAGTCGCTGCCCGAAGGCGGCGCGATGATCGCCGTCCAG
GCCACCGAGGACGAGGTCCTGCCCCTCCTCACCGACGACGTCTCGATCGCCGCCGTCAAC
AGCCCGACCTCCGTCGTCGTCTCCGGCTACGAGAACGCCACCCTCGCCGTCGCCCGGCAC
TTCGCCGACCAGGGCCGCCGCACCACGCGGCTGCGCGTCAGCCACGCCTTCCACTCGCCG
CTGATGGCGCCGATGCTCGACGACTTCCGCGCCGTCGTCGAGAGCCTCACCTTCACCGCC
CCCACGACCCCCGTCGTCTCCAACCTGACCGGCGAACTGGCCCCGGCCGAGGCGCTCTGC
TCGGCCGACTACTGGGTCCGGCACGTCCGCGAGGCGGTCCGCTTCGCCGACGGCATCCGC
ACCCTCGCCGACCGCGGCGTCACCACCTTCGTCGAACTCGGCCCCGACAGCGTGCTGTCC
GCCATGGCCCAGGAGTCCGCCCCCGAAGGCGCCGGCACCATCCCGCTCCTGCGCCGCGAC
CGGCCCGAGGAACAGGCCGTCCTGGCCGCCCTCTGCCACCTCCAGGTGCTCGGCGTCGAG
GCCGACTGGTCCGCCACCTTCCGCGGCCTCGACCCCGTCCGCGTCGACCTGCCGACCTAC
GCCTTCCAGCACCGCTGGTTCTGGCCCGCCGCCCGACCCGCCCGCCCCGACGACGTCCGC
GCCGCCGGCCTGGGCGCCGCCGAACACCCCCTCCTCGGCGCCGCCGTGCAACTCCCCGAC
GACGACGGCGCACTCTTCACCGGCCGCCTCTCCCTGCGCACCCACCCGTGGCTGGCCGAC
CACACCGTCCTGGGCACCGTCCTGCTCCCGGGCACCGCACTGGTGGAACTCGCCGTCCGC
GCGGGCGACGAGACCGGCAGCGGCCACCTCGAAGAACTCACCCTCGCCGCGCCCCTGACC
CTCCCCGAGGACGGCGCCACCCTCCTCCAGGTCCGCGTCGGATCCGCCGACGACACCGGC
CGCCGCACCGTCACCGTCCACGCCCGCCCCGACGACACCGCCGACCGCACCTGGACGCTG
CACGCCACCGGTGTGCTCGCCACCACGCCACCGGCCGCCGCGGCGTTCGACACCACGGTC
TGGCCGCCCGCCGACGCCGAACCCCTCACCACCGACGACTGCTACGCACACTTCACCACC
CACCGCTTCGCCTACGGCCCCGCCTTCCAGGGCCTGCGGGCCGCCTGGCGCGCCGGCGAC
GTGCTGTACGCCGAGGTCGCCCTGCCGGAGTCCGCCACCGACGAAGCGGCCGCCTTCGGC
CTGCACCCGGCGCTCCTGGACGCCGGCCTGCACGCCGCGCTCCTCGCCGACGACCGCGAC
ACCGGACTCCCGTTCTCCTGGGAAGGCGTCACTCTGCACGCCTCCGGCGCCACCGCGCTA
CGCGTCCGGCTCGCCCCGAACGGCCCCAACGGCCTGTCCGTCACCGCCGCCGACCCGGCC
GGCAACCCCGTCGCCACCGTCACCCGCCTGCTCGCCCGCCCCCTGGACGCCGAGCAGTTG
ACCATCCACAGCGCCCTGACCCGCGACGCGCTCTTCCACCTGGACTGGACCCCGGTCCCG
CTTCCCGACACCGCCAACTCCGCGCCGCCGGCCCTCCTCGGCCCGGACACCGCCGTGCTC
GCCGACGCCCTCGGCGACCCGGCCGTCGCACGCCACGCAACCCTCGACGACCTCCTGGCC
GGGGACACCACCCCGCCCGCCACGGTCCTCGTCCCCCTCGGCGCCCCACTCGACGGCGAC
ACCGCGCAGCACGCGCACGCCCTCACCCGCAGCGCGCTGACCCTCGTCCAGCAGTGGCTC
GCCACCGACCGCCTCGCCGACTCCCGCCTGGTCTTCGTCACCCACGGAGCCGTCGCCACC
GACGACGCGCCCCCCACCGACCTGGCCGCCGCCGCGGTCTGGGGCCTGATCCGCTCCGCG
CAGACCGAGAACCCCGGCACCTTCACCCTCCTCGACCTCGACACCGAGCCCGACTCGACC
ACCGCGCTCAGCCGCGCCCTGACCCTCGACGAACCACAGCTCCTCCTCCGCGCCGGCCGC
GCCCGCGCCGCCCGCCTCACCCGCACCCCCGCCCCCACCACCACCACCCACACGCCGTGG
TCCGCGGACGGAACGGTGTTGGTGACGGGTGGTACGGGTGGTCTGGGTGGGTTGGTGGCC
CGGCATCTGGTGCGGTCGTGTGGGGTGCGGCATTTGTTGTTGACCAGTCGTTCTGGTGTG
GGTGCTGCGGGTGCGGCCGGGTTGGTCGCGGAGTTGGAGTCGTTGGGCGCGCGGGTTGTG
GTTGCGGCGTGTGATGTGGGTGATGGCTCGGCTGTTGCGGAGTTGGTTGCCGGTGTGTCG
GAGTCGTATCCGTTGTCTGCGGTGGTGCATGCGGCTGGTGTGTTGGATGACGGTGTGGTG
GGTTCGTTGACGCCGGAGCGGTTGGCTGCGGTGTTGCGTCCGAAGGTGGATGGTGCGTGG
AACCTGCATGAGGCGACGCGTGGTCTGGATCTGGACGCGTTTGTTGTCTTCTCGTCTGTT
GCGGGTGTGTTCGGGGGTGCGGGTCAGGCCAACTATGCGGCGGGTAATGCGTTTTTGGAC
GCGTTGATGGTTCATCGGGTGGCTGGTGGGTTGCCTGGTGTGTCGTTGGCGTGGGGTGCT
TGGGATCAGGGTGTGGGGATGACGGCGGGGCTGACGGAGCGGGATGTCCGTCGTGCTGCT
GAGTCGGGTATGCCGTTGTTGACGGTTGATCAGGGTGTGGCGTTGTTCGATGCGGCGTTG
GCGACGGGGAGTGCCGCGTTGGTGCCGGTCCGTCTGGACCTGGCCGCACTGCGCACCCGG
GGCGACATCGCACCGCTCCTCCGCGGCCTCGTCCGCGCACCGCTGCGCCGCACCGCGGCC
ACCGGCCTCGCCACCGGCGCGGACACCGGCCTCGTCCAACGGCTCGGCCGACTCGACCAC
GCCCAACGCCACGAGGCACTGCTCGACATGGTCCGCAGCAGCGCCGCGCTCGTCCTCGGC
CACGCCGACGGCAACGCCATCGACGCCGAACGCGCCTTCCGCGACCTCGGCTTCGACTCG
CTCACCGCGGTCGAACTCCGCAACCGTCTGCGCACCGCCACCGGCCTGCACCTGTCGGCC
ACCATGGTCTTCGACCACCCCACCCTGTCCGCCCTCGCGGAGCACCTGCGGGACGAGTTG
TTCGGCGCGGTCGAGAGCGAGGTGCGGGTGCCGGTCCAGGCACTGCCGCCGACCGCCGAC
GATCCCATCGTGGTGGTGGGCATGGCCTGCCGTTTCCCCGGTGGTGTGACCTCGCCCGAG
GACCTGTGGCGCCTGGTCGACGACGGCACCGACGCCATCACCACCTTCCCGACCAACCGC
GGCTGGGACCTGGACAACCTCTACGACCCGGACCCCGAGCACTTCGGCACGTCGTACACC
CGCTCCGGTGGCTTCCTGCACGAGGCGGGGGAGTTCGACCCGGCGTTCTTCGGAATGAGC
CCGCGTGAGGCGCTGGCAACCGACTCCCAACAGCGTCTCCTGCTGGAATCCTCCTGGGAG
GCGATCGAGCGGGCCGGCATCGACCCGCTGACCCTGCGCGGCAGCGCCACCGGCGTCTTC
GCCGGCGTGATGTACAGCGACTACGGGAGCATCCTCGGCGGCAAGGAGTTCGAGGGCTTC
CAAGGCCAGGGAAGTGCGGGCAGCGTGGCCTCGGGCCGCGTCTCCTACGCCCTCGGCTTC
GAGGGCCCGGCCGTCACGGTGGACACGGCTTGCTCTTCCTCTCTGGTCGCCCTGCACTGG
GCGGCGCAGGCGTTGCGGGCGGGGGAGTGCTCGTTGGCGTTGGCCGGTGGTGTGACGGTG
ATGTCGACGCCGAGCACGTTCGTGGAGTTCTCGCGGCAGCGGGGTCTGGCGCCTGATGGT
CGTTCCAAGGCGTTCGCCGAGGCCGCGGACGGCGTCGGCTGGTCCGAGGGCGTCGGCATC
CTCGTCCTGGAGCGCCAGTCGGACGCGGTGCGCAACGGCCACGAGATCCTCGCCGTGATC
CGCGGCTCGGCGGTCAACCAGGACGGTGCGTCCAACGGCCTGACCGCGCCCAACGGCCCG
TCCCAGCAGCGCGTCATCCGTCAGGCGTTGGCCAGTGGCGGCCTGTCCACGGCCGACGTG
GACGCCGTCGAGGCGCACGGCACGGGTACGACGCTCGGTGACCCGATCGAGGCCCAGGCG
CTCCTGGCCACCTACGGCCGTGACCGCGACCCCGAGAACCCCCTGTGGCTGGGCTCCCTG
AAGTCCAACATCGGGCACACCCAGGCAGCGGCCGGTGTCGCCGGTGTCATCAAGATGGTC
ATGGCGATGCGGCACGGCGTGCTGCCGCAGACCCTGCATGTCGACGCGCCGTCCTCGCAC
GTCGATTGGAGCGTCGGCGCCGTCGAACTGCTCACCGAGCAGACCGCCTGGCCGGAGACC
GGCCGGGTCCGTCGCGCCGGTGTCTCCTCCTTCGGCATCAGCGGCACCAACGCCCACGTC
ATCGTGGAACAGCCGGCGCTCGTCGAAAGCCCGGCCGCGGAGCCGAGCGGACGCGAACCC
GGCGTCGTTCCGCTGCCGCTGTCCGGAAAGTCCCCCGAGGCCCTGCGCGACCAGGCCGCA
CGCCTGCTGGCCGGGTTGGCGGAGCGGCCCGCGCTGCGCCCGCTCGACCTCGGCTACTCG
CTGGCGACGACCCGTTCGGCGTTCGACCACCGGGCGGTGGTGCTCGCCACCGACCGCGCC
GATGCGGTCCGCGCGCTGACGGCGCTCGCCGCCGCCGACGCGGATCTCTCCGCCGTCGTC
GGCGACACCCGCACGGGTCGTCACGCGGTGCTGTTCTCGGGTCAGGGCTCGCAACGCCTG
GGCATGGGGCGTGAGTTGTACGAGCGTTTCCCGGTCTTCGCCGAGGCTCTCGATGTCGCG
ATCGACCACCTGGACGCCGCCTTGCCCGCCCAGGCCAGTCTGCGTGAGGTGATGTGGGGC
GACGATGTCGAGCTGCTGGACGAGACGGGTTGGACGCAGCCGGCTCTGTTCGCCGTCGAG
GTGGCCCTGTTCCGGCTGGTGGAGAGTTGGGGTGTCCGTCCGGACTTCGTGGCCGGTCAT
TCCATCGGTGAGATCGCGGCGGCGCATGTCGTCGGGGTGTTCTCGCTGGAGGACGCCTGC
CGTCTGGTGGCCGCCCGTGCGACGCTGATGCAGGCGCTGCCGACCGGCGGCGCGATGATC
GCGATCCAGGCCGCCGAGGACGAAGTCACCCAGCACCTGACTGACGACGTCTCGATCGCC
GCCGTCAACGGCCCGACCTCCGTGGTCGTCTCCGGGGCCGAGAGCGCTGCCCGCACGGTG
GCCGACCGGCTCGCGGAGAACGGCCGCAAGACGACCCGGCTGCGGGTCTCGCATGCGTTC
CACTCGCCGTTGATGGATCCGATGCTGGCGGAGTTCCGTGCGGTGGCCGAGGGCCTGTCC
TACGCCACCCCGACCCTCCCCGTCGTCTCGAACCTGACGGGCCGGCTGGCCACGGCCGAT
GACCTCTGCTCGGCCGAGTACTGGGCGCGCCACGTCCGCGAGGCGGTCCGCTTCGCCGAC
GGCGTCAGCACCCTGGAGAACGAGGGCGTCACCACGTTCCTGGAACTGGGACCGGACGGC
GTGCTGTCCGCCATGGCCCAGCAGTCGCTCACCGGCGACGCCGCCACCGTCCCGGCCCTC
CGCAAGGACCGCGACGAGGAGACGTCCGCGCTCACCGCCCTCGCCCACCTCCACACGGCA
GGTCTCCGCGTCGACTGGGCGGCGTTCTTCGCCGGCAGCGGCGCCACCCGCGTGGACCTG
CCGACCTACGCCTTCCAGCACGCCACCTACTGGCCCACCGGCACCCTGCCCACCGCGCAC
GCCGCGGCCGTCGGCCTCACCGCCGCCGAGCACCCGCTGCTGAACGGTTCGGTCGAACTC
GCCGAAGGCGAAGGGGTGTTGTTCACCGGACGGCTGTCACTGCAGTCACATCCGTGGCTG
GCCGACCACGCCGTCATGGGACAGGTCCTGCTGCCCGGCACCGCACTGCTGGAACTGGCG
TTCCGGGCCGGCGACGAGGCCGGTTGCGACCGCGTCGAGGAACTGACGCTCGCCGCACCG
CTCGTCCTGCCCGAGCGCGGTGCGGTACAGACCCAGGTCCGGGTCGGCGTCGCCGACGAC
ACCGGCCGCCGTACCGTCACCGTCCACTCCCGGCCCGAGCACGCGACCGACGTGTCGTGG
ACCCAGCACGCGACCGGCACCCTGACCATGGGCTCCGCCCCGGCCGACACCGGTTTCGAC
GCCACTGCCTGGCCGCCCGCCGACGCCGAACCCCTCGCCACCGACGACTGCTACGCGCGC
TTCACGACGCTCGGCTTCGCCTACGGGCCGGTCTTCCAGGGCCTGCGGGCCGCCTGGCGC
GCCGGTGACGTGCTGTACGCCGAGGTGGCCCTGGCGGAGTCCACCGGCGACGAGGCGACC
GCCTTCGGTCTGCACCCCGCACTGCTCGACGCCGCCCTGCACGCCTCCCTCGTCGCCCAC
GAGGGCGAGGAGAGCAACGGCGGACTGCCGTTCTCCTGGGAGGGCGCGACCCTCTACGCG
ACCGGCGCCACCGCGCTGCGCGTCCGGCTGACCCCGACGGGCACCGACGGCCGTTCGGTG
GCCATCGCCGTGGCCGACACCGCCGGTCGTCCGGTCGCCGCCATCGACAACCTCGTCTCG
CGCCGGGTCTCCGGCGACCAGTTGACCGGCGCCGCGGGACTGGCCCGCGACGCCCTGTTC
ACCCTGGACTGGAACCCCGTACCGGAGAACCTCGTACCGGAGAACCCTGTACCGGAGAAC
ACCGGCGGGGGCCACGCCCAGGACCAGGACGGCCGGCCCGCCGCGGCCACCGTCGCGCTG
GTCGGCGCGGACGGCACCGCGATCGCCGCCGACCTGACCGCCGCCGGCATCCACACCACC
CTCCACCCCGACCTCACCACCCTCGCCACGACCGACGCCGACGTTCCGAAGACGGTCCTC
ATCCCCCTCACCGGAACCGGAACCGGAACCGGCACCGGGACTGAGTCGACGGACGGAATC
GGGACGGGGGCCGCCGAGTCGGACGCGTCCGCCCCCTCCCCGGCCGAGGTCGCCCACACC
CTGTCCACCGCCGCACTCGCCCTCGTCCAGGAGTGGACCGCACAGGAGCGCTTCGCCGGC
TCCCGCCTGGCGTTCGTCACGACCGGGGCGACGGCCGCCGGCGGTACCGACGTCATGGAC
GTGGCCGCCGCCGCGGTCTGGGGCCTGGTCCGATCCGCCCAGTCCGAAGCCCCGGACACC
TTCGTCCTGATCGACCGTGACCCCGGCCCGGCCGGCACGCACGACCGCACAGCCGCCGCC
GAACGGGGCCAACTGCTCCTACGGGCACTGCACACCGACGAACCGCAGCTCGCCCTGCGT
GACGGCGGCGTGCTCGCCGCCCGCCTGGCCCGCTTCGACACCGCGGCCGCGCTCACCCCG
CCGGCCGACCGGGCCTGGCGGCTCGACAGCACGGCCAAGGGCAGCCTCAACGGCCTCGCC
CTGACCCCGTATCCGGCGGCACTGGCGCCGCTCACCGGCCACGAGGTGCGGGTCGAGGTG
CGTGCCGCGGGCCTGAACTTCCGTGACGTGCTCAACGCGTTGGGGATGTATCCGGGTGAT
GATGTCGGATCGTTCGGTTCGGAGGCGGCCGGTGTGGTCGTCGAGGTCGGACCGGAGGTG
ACCGGCCTGGCCCCCGGCGACCAGGTCATGGGCATGATCACCGGCAGCTTCGGCTCGCTC
GCCGTGGACGACGCGCGGCGCCTCGCCCGCCTGCCCGAGGACTGGTCCTGGGAGACGGGT
GCGTCGGTGCCGTTGGTGTTCCTCACCGCGTACTACGCCCTGAAGGAGTTGGGTGGTCTG
CGGGCGGGGGAGAAGGTGCTGGTGCATGCCGGTGCCGGTGGTGTCGGTATGGCGGCGATC
CAGATCGCCCGGCATGTCGGTGCCGAGGTGTTCGCCACGGCCAGTGAGGGCAAGTGGGAC
GTGTTGCGCTCGCTCGGCGTGGCCGACGACCACATCGCCTCCTCCCGCACCCTCGACTTC
GAGGCGGCCTTCGCCGAAGTCGCCGGCGACCGCGGCCTGGACGTCGTCCTCAACTCCCTC
GCCGGTGACTTCGTCGACGCCTCGATGCGGTTGCTCGGCGACGGCGGCCGGTTCCTGGAG
ATGGGCAAGACCGACATCCGCGCCGCGGACTCCGTTCCCGACGGCCTCTCCTACCAGTCC
TTCGACCTCGCCTGGGTGGTGCCGGAAACCATCGGCACCATGCTGGCCGAGCTGATGGAC
CTCTTCCGCACCGGCGCACTGCGGCCACTCCCGGTCCGCACCTGGGACGTCCGGCACGCC
AAGGACGCGTTCCGCTTCATGAGCATGGCCAAGCACATCGGCAAGATCGTGCTCACCCTG
CCCCGCTCCTGGAAGCCCGAGGGAACGGTGTTGGTGACGGGTGGTACGGGTGGTCTGGGT
GGGTTGGTGGCCCGGCATCTGGTGCGGTCGTGTGGGGTGCGGCATTTGTTGTTGACCAGT
CGTTCTGGTGTGGGTGCTGCGGGTGCGGCCGGGTTGGTCGCGGAGTTGGAGTCGTTGGGC
GCGCGGGTTGTGGTTGCGGCGTGTGATGTGGGTGATGGCTCGGCTGTTGCGGAGTTGGTT
GCCGGTGTGTCGGAGTCGTATCCGTTGTCTGCGGTGGTGCATGCGGCTGGTGTGTTGGAT
GACGGTGTGGTGGGTTCGTTGACGCCGGAGCGGTTGGCTGCGGTGTTGCGTCCGAAGGTG
GATGGTGCGTGGAACCTGCATGAGGCGACGCGTGGTCTGGATCTGGACGCGTTTGTTGTC
TTCTCGTCTGTTGCGGGTGTGTTCGGGGGTGCGGGTCAGGCCAACTATGCGGCGGGTAAT
GCGTTTTTGGACGCGTTGATGGTTCATCGGGTGGCTGGTGGGTTGCCTGGTGTGTCGTTG
GCGTGGGGTGCTTGGGATCAGGGTGTGGGGATGACGGCGGGGCTGACGGAGCGGGATGTC
CGTCGTGCTGCTGAGTCGGGTATGCCGTTGTTGACGGTTGATCAGGGTGTGGCGTTGTTC
GATGCGGCGTTGGCGACGGGGAGTGCCGCGTTGGTGCCGGTCCGTCTGGACCTGGCCGCA
CTGCGCACCCGGGGCGACATCGCACCGCTCCTCCGCGGCCTGGTCAAGGCGCCCATCCGC
CGCGCAGCCGCCACCACACCCGGCGACACCGGACTCGCCGAGCAGCTCACCCGGCTCCAG
CGCGCCGAGCGACGGGACACCCTCCTCGCGCTCGTCCGCGACCAGGCCGCGATGGTCCTC
GGCCACACCTCGGGCGACGGCGTCGACCCGTCCCGCGCCTTCCGCGACCTCGGCTTCGAC
TCGCTCACCGCGGTCGAACTCCGCAACCGCATCGGCGCGGCCACCGGCCTGCGGCTACCG
GCCACGGCCGTCTTCGACTACCCCACCGCCGATGCCCTCGCCGCACACCTGCTCACCGAA
CTGCTCGGCCCCGACGCCGAGTCGGACCCCGACGAGCCCGGCGACCCCACCGCGGGACCG
ACCGACGACCCCATCGTCATCATCGGCATGAGCTGCCGCTTCCCCGGCGACATCGGCTCG
CCGGAGGACCTGTGGCGCCTGCTCGGCGACGGCGCCGACGTCGTCACCGACTTCCCGACC
AACCGCGGCTGGGACCTGGACAACCTCTACGACCCCGACCCCGCGCACGCCGGCACCTCG
TACGCCCGCACCGGCGGTTTCCTGCACGACGCCGCCGACTTCGACGCCGACTTCTTCGGC
ATGAGCCCCCGCGAGGCCATGGCCACGGACTCCCAGCAGCGCCTGCTGTTGGAGTCCTCG
TGGGAGGCGATCGAGCGGGCCGGCATCGACCCGCTGACCCTGCGCGACAGCCGCACCGGC
GTCTTCGCCGGCGTCATGTACAGCGGCTACGGCACCCGCCTCGACGGCGCCGAATTCGAA
GGCTTCCAGGGGCAGGGCAGCGCACTGAGCGTGGCCTCCGGCCGGGTCTCCTACACCTTC
GGCTTCGAAGGCCCGGCCATGACGGTCGACACCGCCTGCTCCTCCTCGCTGGTCGCCCTG
CACCTCGCCGCACAGGCACTCCGCGGCGGTGAGTGCACCCTCGCCCTCGCCGGTGGTGTC
ACCGTGATGTCCATCCCGGACACCTTCATCGAGTTCTCCCGGCAGCGCGGACTGGCCCCC
GACGGCCGCTCCAAGCCGTTCTCCGAGTCCGCCGACGGCGTCGGCTGGTCCGAGGGCGTC
GGAATGCTGCTCCTGGAGCGCCAGTCGGACGCCGTGCGCAACGGCCACCAGATCCTGGCC
GTGGTGCGCGGCTCGGCGGTCAACCAGGACGGTGCGTCCAACGGCCTGACCGCGCCCAAC
GGCCCGTCCCAGCAGCGGGTGATCCGTCAGGCGTTGGCCAGCGGCGGCCTGTCCACGGCC
GACGTGGACGCCGTCGAGGCGCACGGCACGGGCACCACGCTCGGTGACCCGATCGAGGCC
CAGGCCCTCCTGGCCACCTACGGCCGCGACCGCGACCCCGAGAACCCGCTGCTGCTCGGT
TCGATCAAGTCCAACCTCGGCCACACCCAGGCAGCCGCCGGTGTCGCCGGCGTCATCAAG
ATGGTCATGGCGATGCGGCACGGCGTGCTGCCCCGCAGCCTGAACATCACCGAGCCGTCC
TCGCACGTCGATTGGAGCGCCGGCGCCGTCGAACTGCTCACCGAGCAGACCGCCTGGCCG
GAGACCGGCCGGGCCCGTCGCGCCGGTATCTCCTCCTTCGGCATCAGCGGCACCAACGCC
CACGTCATCCTGGAGCAGCCGGAGGCCGCGCGGCACTCGGCGCCGGAAGAAGCCGACACG
GCGGAGGCAGCCGCCAAGGCGCCGGCCACCGCGCACCTGCCCGTAATGCCGTGGGCACTG
TCCGGCAAGACGCCGGAGGCCCTGCGTGCCCAGGCCGCACGCCTCCTCGCCCACCTCCAG
CAGCGCCCCGAACTCGCACCCGCCGACATCGCCCTGTCCCTCGCCACCCAGCGCTCCCAG
TTCACCCACCGGGCAGTCGTCCTGAGCACCGACCGTGACGAGGCGACCCGCGCGCTGTCC
GCCCTCGCCACCACCGCCGCGTCCGACCCCTCGGCCCTCACCGGCACGGTCACCATGGGA
CGTTGCGCGGTGCTGTTCTCGGGTCAGGGCTCGCAACGTCTGGGCATGGGGCGTGAGTTG
TACGAGCGTTTCCCGGTCTTCGCCGAGGCTCTCGATGTCGTGATCGATCACCTGGACGCC
GCCTTGCCCGCCCAGGCCGGTTTGCGTGAGGTGATGTGGGGCGACGATGTCGAGTTGCTG
AACGAGACGGGTTGGACCCAGCCCGCGCTCTTCGCCATCGAGGTGGCGCTGTTTCGGCTG
GTGGAGAGTTGGGGTGTCCGTCCGGACTTCGTGGCCGGTCATTCCATCGGTGAGATCGCG
GCGGCGCATGTCGTCGGGGTGTTCTCGTTGGAGGACGCGTGCCGTCTGGTGGCCGCGCGG
GCGACGCTGATGCAGGCGTTGCCGGCCGGTGGCGCGATGATCGCGGTCCAGGCGACCGAG
GACGAAGTCATCCCGCACCTGACCGACGAGGTGGCGATCGCGGCCGTCAACGGCCCGACC
TCCGTGGTGATCTCGGGCGCAGAAGAGGCCACGCAGACCGTGGCACAACACTTCGCCGAC
CAGGGGCGCCGGACGACCGCGCTGCGGGTCTCGCATGCGTTCCACTCGCCGCTGATGATG
CTGGCGGAGTTCCGTGCGGTGGCCGAGGGCCTGTCCTACGCCACCCCGACCCTCCCCGTC
GTCTCGAATCTGACGGGCCAGGTGGCCACGGCCGACGAACTCTGCTCGGCCGAGTACTGG
GTGCGCCACGTCCGTGAGGCGGTCCGCTTCGCCGACGGTGTGACGGCCCTCGAAGCCGAG
GGCGTGCGGACCTTCCTGGAACTCGGCCCGGACGGCGTCCTCGCCGCCATGGCCAGGGAA
ACCGTCGCCGACGACACGGTCACCGTCCCCGTCCTCCGCAGGAACATGCCCGAGGAACGG
ACCCTGCTCACCGCACTCGGCCGGCTCCACACCACCGGAACCCCGATCGACTGGGCCGCC
CTCCTGGCCCCGACCGGCGCCCGCCCGGTGGACCTGCCGACATACGCGTTCCAACACCGT
CCCTTCTGGCCCTCCGGCCCCCGCGACACCGCGGATGCCGCCGCCGTCGGCATCGCCGGC
GCGAGCCACCCGCTCCTCAACGGCATCGTCGAACTCGCCGACGAAGAGGGCCTGTTGTTC
ACCGGACGGCTGTCACTGCAGTCGCATCCGTGGCTGGCCGACCACGCCGTCATGGGACAG
GTCCTGCTGCCCGGCACCGCACTGCTGGAACTCGCCCTGCGCGCCGGCGACGAGGTCGGC
TGTGACCACGTCGAGGAACTGACGCTCGCCGCACCGCTCGTCCTGCCCGAGCGCGGCGCG
GTACAGACCCAGGTCCGGGTCGGCGTCGCCGACACCACCGGGCGCCGCACCGTCACGATC
CACTCGCGTCCCGCACGCGCCACGACCACCGACAGTGACACCCACACCGGCACCGACACC
CCGTGGACCCAACACGCCACCGGCGTCCTCGTCGCCGGCCTGCCGGCGACGGCAACCGTC
CCGTTCGATGCCACCGTGTGGCCGCCGGCGCACGCCGAACCCGTTGACCTGGCGGACTTC
TACGCGTCCCGGGCCGGCGAAGGATTCGGCTACGGGCCCGCTTTCCAGGGCCTGCGAGCG
GCCTGGCGCCGCGACGGCGAGGTGTTCGCCGATGTCGCACTGCCGGAGGCCGGCCGTACC
GAAGCCGAGGCGTACGGGCTGCATCCGGCACTGCTCGACGCCGGACTGCACGCAGCCTGG
CTCGTCGCCCCGGACGGGGAGCCCACACGGACGGGCAGCGTGCCGTTCTCGTGGCGCGGC
GTCTTCCTGGCCGCTTCCGGTGCCTCCTCGGTCCGCGTCCGACTCGGCCGCGACTCCGAC
GGAACGCTGAGCCTGGCCATCGCCGACACCACCGGTGCACCGGTCGCGTCCGTACAGGCC
CTCTCCATGCGCACCGTCTCGGTGACGGCCCTGAGCGCCACCGCGGGCCTCGCCCGCGAC
GCGCTGTTCCGCCTGGACTGGGCCTCGGCCCCGGAGCCGGCGTGCCAGCCGGACGACACG
GTGACCGTGATCCCGGCGGTCGCGGTCGTCGGTACGGAAACCTCCGAACTCACCTCCGAG
CTCACCGCGGCCCTGCGTGCGGCGGGCGCCGACGTCGACGTCCGCACGACCCTGTCGACC
GATGAACCCGCGCCCGCGCTGATCGCGCTGCCGCTCGTCGCCTCCGACCAGACCGGCACC
GCAGAAGCGGCACCCGTCCCGGCGGCCGTGCACGACCTCACCCGCCGAGCCCTGGCCCTC
GTACAGACCCGCCTGCAAGAGCAGCACTTCGCGGACACGAAGTTCGTCTTCGTGACCCGT
GGTGCGACGGTCGGGCGTGATGTGGCTGCTGCTGCGGTGTGGGGTCTGGTGCGTTCGGCG
CAGTCGGAGAATCCGGGTTGTTTTGCTCTGGTCGATCTGGATCCGGATGGTGCGGTGGGT
GCGGCTGCGCTCGTCGCTGCGTTGGTCAGTGGTGAGCCGCAGCTTGCGGTGCGCGGTGAT
GTGTTGCGGGTCGCGCGTCTGGTGCGGCGGCCGCTCACCGAGGTCGGTGCGGGTGCTGAT
GGCACCGGGGATGGCGTCGGGGGTGGCTCTGGTGTGTCGTTCTCGGGTGAGGGTGCGGTC
CTGGTCACTGGTGGTACGGGTGGTCTGGGTGCGGTGTTGGCGCGTCATCTGGTGGCCGAG
TATGGGGTGCGGGATCTGCTGTTGGTCAGTCGCAGTGGTGAACGTGCCGTGGGTGCTGGG
GAGTTGGTGGCGGAGCTTGCGGGTGTGGGTGCGCGGGTGCGGGTGGTTGCGTGTGATGTG
ACCGATCGTGCCGCGGTGGTGGAGTTGGTTGGCGGGCATGCGGTGTCCGCGGTGGTTCAT
GCGGCTGGTGTGCTGGATGACGGCATGGTGGGTGCGTTGACCGGGGAGCGGTTGTCCGCG
GTGCTGCGGCCGAAGGTGGATGCTGTCTGGCATCTGCATGAGGCGACCCGCGGCCTGGAT
CTGGACGCGTTCGTCGTCTTCTCCTCTCTCGCCGGGGTCTTCGGCAGTCCCGGCCAGGCC
AACTACGCGGCCGCGAACGCCTTCCTGGACGCGCTGATGACGCGGCGCCGGGCGGAGGGA
CTGCCCGGCCTGTCACTCGCATGGGGACCGTGGTCGCTGACCGATGGCACATCGGGCATG
CTCGCGGACGCCGAGGCCGATCGCCTGACCCGTTCGGGAGTGCCACCGCTGACCGCGGAG
CAAGGACTGGCACTGTTCGACGCGGCCCTGGCGACCGGTGACGCCACCTGCGTCCCGGTC
CGCCTGGACCTGTCGGCACTGCGTGCCCAGGGTGAGGTGCCGCCCTTGCTGCGGTCCCTG
ATCCGAGGCCGCTCGCGCCGCGCCGCCGCCGCGGAATCGGCAACCGCCACCGGGCTGCGG
GAACGGCTCGTCGGACTGAACCCGGTCGAGCGACAGGAAGTCCTCCTGGACCTCGTGCGC
GGCCAGGTGGCCCTGGTCCTCGGCCACGCCGACGCCGACGACGTTCATCCGGCACGTGCC
TTCAGGGAGTTGGGCTTCGACTCCCTCACCTCGGTGGAACTGCGCAACCGCCTCAACACC
GTCACCGGTCTGCGGCTCCCCGCGACCATGGTGTTCGACTATCCGACCGTCGAAGTGCTG
GTCTCCTACGTCCTGGACGAGTTGCTGGGCACGGATGCCGAGGTGGCGACCGTGCAGCCG
GCCGCGGTTGCGGTGGCGGACGATCCGATCGTCATCGTGGGCATGGCCTGCCGCTACCCC
GGCGGGGTCGCCTCTCCGGACGACCTGTGGAGGCTCGTCACGGACGGCGTCGACGCGGTG
TCCCCCTTCCCGACCAACCGTGGTTGGGACGTCGAATCCCTCTATCACCCGGACCCCGAC
CATCTCGGTACCTCCTACACGCGCTCGGGTGGGTTCCTGCATGAGGCGGGGGAGTTCGAT
CCGGGGTTCTTCGGGATGAGTCCGCGGGAGGCGTTGGCGACCGATTCCCAGCAGCGGTTG
TTGTTGGAGTCGTCGTGGGAGGCGATCGAGCGGGCCGGTATTGATCCGGTGAGTTTGCGG
GGTAGTCGGACGGGTGTGTTCGCGGGGGTGATGTACAGCGATTACAGCGCGATGTTGGCG
AGTCCGGAGTTCGAGGGTTTCCAGGGCAGTGGGAGTTCGCCGAGTTTGGCGTCGGGTCGG
GTGGCCTACACGTTGGGGTTGGAAGGCCCGGCGGTGACGGTGGATACGGCGTGTTCGTCG
TCGTTGGTGGCGATGCACTGGGCGATGCAGGCGTTGCGTAGTGGTGAGTGTGGGTTGGCG
TTGGCCGGTGGTGTGACGGTGATGTCGACGCCTGCGGTGTTTGTGGACTTTGCTCGGCAG
CGGGGTTTGTCGCCGGATGGTCGGTGCAAGGCGTTTGCGGATGCGGCCGATGGTGTGGGC
TGGTCCGAGGGCGTCGGCGTGTTGGTCCTGGAGCGGCAGTCGGACGCGGTGCGCAATGGT
CACGAGATTTTGGCTGTGGTGCGGGGTTCGGCGGTCAACCAGGATGGTGCGTCCAATGGT
TTGACGGCGCCCAATGGTCCGTCGCAGCAGCGGGTGATCCGGCAGGCGTTGGCCAGTGGT
GGTCTGACGGCCGGTGACGTGGATGTGGTGGAGGCGCATGGTACGGGTACGACGCTCGGT
GATCCGATCGAGGCGCAGGCGTTGTTGGCGACGTATGGGCGGGATCGTGAGCCTGAGCGG
CCGTTGTTGTTGGGTTCGGTGAAGTCGAATCTGGGGCATACGCAGGCTGCTGCGGGTGTG
GCGGGCGTTATCAAGATGGTGTTGGCGATGCGGCATGGTGTGGTGCCGCGGACGTTGCAT
GTGGATGCGCCTTCTTCGCATGTGGACTGGTCCGAGGGTGCGGTGGAGCTGCTCAGTGAG
CAGGCGGCTTGGCCGGAGACGGGTCGGGTGCGGCGGGCGGGTGTCTCCTCCTTCGGCATC
AGCGGCACCAACGCGCACGTGATTCTGGAGCGTCCGGAGGCCGCGCGGCGTCCGGTGATG
GAGACGAACACCGTGGAGCCGTCCACGGTGCCGTGGGTGCTTTCCGGCAAGACACCGGAG
GCCCTGCGCGCCCAGGCGGCGAAACTGTTGTCGTCGATCGAGGAACGCCCGGAGCTTCGC
CTCGTCGACGTGGGAATGTCCCTGGTCACCGGCCGCTCGACCTTTGAACACCGTGCGGTG
GTACTCGCCGCCGACCGTGCCGACGCCGCCCGCGCATTGTCGGCGATTGCTGCCGACGAG
GCCGATGCTGCCGCTGCCACCGGCCGCGTCGGCGCGGGTCGTCACGCGGTGCTGTTCTCG
GGTCAGGGTGCTCAACGTCTGGGCATGGGGCGTGAGTTGTACGAGCGTTTCCCGGTCTTC
GCCGAGGCTCTCGATGTCGTGGTCGACCACCTGGACGCCGCCTTGCCCGCCCAGGCCGGT
TTGCGTGAGGTGATGTGGGGCGACGATGCGGAGTTGCTGAACGAGACGGGTTGGACGCAG
CCGGCTCTGTTCGCCATCGAGGTGGCGCTGTTCCGGCTGGTGGAGAGTTGGGGTGTCCGT
CCGGACTTCGTGGCCGGTCATTCCATCGGTGAGATCGCGGCGGCGCATGTCGCCGGGGTG
TTCTCGCTGGAGGACGCCTGCCGCCTGGTGGCCGCCCGTGCGACGCTGATGCAGGCGTTG
CCGGCCGGCGGTGCGATGATCGCGGTCCAGGCGACCGAGGACGAAGTCACCCCGCATCTG
ACCGACGACGTAGCGATCGCCGCCATCAACGGGCCGAACGCACTGGTCGTATCGGGTGTG
GAGGATGCCGCCGTCGAGATCGGGGCGCGGTTCGCGGCCGAGGGGCGTCGCACGACCCGA
CTCCATGTGTCGCATGCGTTCCACTCGCCGTTGATGGATCCGATGCTGGCGGAGTTCCGT
GTGGTGGCGGAGGGCCTGTCCTATGCTGCTCCGTCCCTCCCCGTCGTCTCGAATCTGACG
GGCCAGGTGGCCACGGCCGACGAACTGTGCTCGGCCGAGTACTGGGTGCGCCACGTCCGC
GAGGCGGTCCGCTTCGCCGACGGGGTGACGGCCCTCGAAGCCGAGGGCGTGCGGACCTTC
CTGGAACTCGGCCCGGACGGCGTCCTCGCCGCCATGGCAGGAGCCTCGCTCACCGAATCC
TCCCTCGCGGTACCGCTGCTCCGTAAGGACCGGCCGGAGGAACCGGCGGCACTCGCCGCC
CTGGCCCAGTTGCACATCGCCGGCGCGCGCGTCGATTGGCCCGTGCTCTTCGCTGGTGTG
GGTGCGGGGCGGGTGGAGTTGCCGACGTATGCGTTCCAGCGTGGGTGGTTCTGGCCGGTT
GGTCGGGTTGGTGTTGGTGGTGATGTGGGTGCTGTGGGGCTTGGGTCTGCGGGGCATCCG
TTGTTGGGTGCTGCGGTGGAGTTGGCTGCGGGTGCGGGGGTGGTGTTGACGGGTCGTCTG
TCGTTGTCGTCGCATGGTTGGTTGGCTGATCATGCGGTGATGGGGCGGGTGTTTGTTCCT
GGTACGGCGTTGCTGGAGATGGTGATGCGTGCTGGTGATGAGGTGGGGTGTGGTCGTGTT
GAGGAGCTGACGTTGGCGGCGCCGTTGGTGTTGCCTGAGCGTGGTGGGGTGCGGGTTCAG
GTTGCTGTGGATGCTCCTGATGCTGCGGGTCGTCGTGGTGTGGGGGTGTATTCGTGTCCT
GATGGTGTGGGTCAGGCGGTGTGGTCGCAGCATGCTGTCGGTGTGTTGGCCTCTGGTGTG
GCTGACCAGGTCGGTGGGTTCGGTGACGGTGGTGTGTGGCCGCCGCAGGGTGCGGTGTCG
GTGGATGCTGAGGGCTGCTACGAGCTGTTTGCGGATGCTGGGTTCGGTTATGGCCCGGTG
TTCCAGGGGTTGCGTGCGGTGTGGCGTCGCGGCGAGGAACTCTTCGCAGAGGTCGCCCTG
TCGGACGAGGTTGCTGAGAGCGCTGATACGGCGACCGGTTTCGGGTTGCACCCGGCGTTG
CTGGATGCCTCGCTCCATGCCTCGCTTCTCTCCTCCCTTGAAGGTCAATCCGCCGATGGT
GGGCCTGCGTTGCCGTTCGCGTGGGAGGGTGTTTCCCTCTTCGCCTCGGGTGCGACGGCT
TTGCGCGTGCGGTTGGCGCCGGCGGGTGAGCATGCGGTGTCGGTGACCGCGGTGGATCCG
ACCGGTGCGCCGGTGATTTCCATCGACGCGCTTCGTACCCGTCGCCTCACCCTCGATGAG
GTCAACGCATCTCACACCCAGCTGAGCGATGCGCTCTTCGGCGTCCAATGGACCACGGTC
CCGAGCACCCCGGCCGCCGACCACCCGTCGGTAGCCATCATCGGAACCGACCACCTGGGG
CTCGCCGAAGCGCTCAGCAGTTCCTCTGCTGGCGCGACCACGACCACGACCGCGGCCGCG
TACGAGAGCCTTGACGCGCTGATCGCGGCGGGGCCCGAAGTGTCCGTCCCTGACGTCACA
CTCATCGGTCTCACCACCGAGGACGCCATCGCTCAGTACGTGAACGACCACGACGCCACG
GTGGCCGGCCAAGGCACCATCGGAGCCGGCGCGGCGGCCGTAGACGCGGCTCGCCGCCTC
ACCGCCGAGGCCCTGCGCACGATCCAGGCATGGTTGGCCGACGAGCGTCTGGCGGCAAGG
CGCCTGGTCTTCGTGACCCGCGGCGCGGCCGACGGGCAGGATGTCGCCGCGGCGGCCGTC
CAGGGCCTGGTGCGCTCCGCCCAGACCGAGAACCCGGGCACCTTCGGCCTCCTCGACCTC
GACGGGACCGAGGCGTCGACCGCGGTCCTCGGCGAGGCTCTCACCTCCGACGAACCGCAA
CTGCTTCTGCGCGACGGACACCTGCACGCCGCCAGGCTGACCCGCCTGGCGTCGCCCGCC
GACACGGCCGTGCCCACGGAGTGGAACGCGGACGGCACGGTGCTGATCACCGGTGGTACC
GGCGGGCTCGGCGCGCAGTTCGCACGGCACCTCGTCGACAGGTACGGCGTCCGCAATCTC
CTGCTCGTCAGCCGGCGCGGCCCCGATGCCCCGGGAACCACGGAGTTGGTCGCCGAGCTG
ACGGCGCACGGTGCCGAGGTGGCCGTGCAGGCATGTGACGTGGCCGATGGCGATGCGGTG
GCGGCGTTGGTCGCCGGCGTGCCGGATGAGCACCCGCTGAGGGCGGTCGTCCACACGGCC
GGTGTGTTGGACGACGGAGTGATCGGCTCGCTCACCGAGGAGCGGCTCGCCACCGTCCTG
CGGCCCAAGGCGGATGCCGCCTGGCATCTGCACGAAGCGACCCGCGGCCTGGACCTGGAC
GCGTTCGTCGTCTTCTCCTCCGTCGCAGGGGTCTTCGGCGGCGCCGGCCAGGCCAACTAC
GCCGCGGCCAACGCCTTCCTGGATGCGCTGATGGCCCAGCGCCGGGCAGCGGGCCTGCCC
GGACTCTCGTTGGCCTGGGGGCCGTGGGACCAGACCGGCGGAATGACGGGCATGCTGTCG
GACGCCGAGGCCGACCGCCTCGCCCGCTCCGGCATCCCGCCGCTCTCCGCGGAGCAGGGC
CTCGCCCTCTTCGACGCGGCACTCGCTCTTGCCGGAACCAGCACGCCAGACAGGGCAGCC
GGCAGCGCCGCCGCCAGCACGTCGGGAACCGGCGACACGATCGCCATCCCGGCCGCGGCC
CTCGTCGCACCGGTCCGGCTCGACCTGGCGGCGCTGGCCGCGCAGGGTGAGGTCCCCGCG
ATTCTGCGCGGACTGGTGCGGACCCGCACCCGCCGTACGGCGGCCGGCGGTTCCGTCACC
GTGGCCGGACTCGTCAACCGCCTGTCCGGGCTCACCGCCGACGAGCGGCGCCAGGAACTT
CTCGAACTGGTCCGCACTCAGGCAGCCCTCGTCCTCGGGCACGCCGATCCGGCGTCCGTG
GACTCCACCGCACAGTTCCGTGACCTCGGCTTCGACTCGCTGACCGCCGTCGAGCTGCGC
AACCGGCTGAGCACGGCCACCGGCCTGCGCCTGACCGCAACCCTGGTCTTCGACTACCCG
AACACCGATGCCCTCGCGGAGCACCTGCGGGACGAGTTGTTCGGCGCGGTCGAGAGCGAG
GTGCGGGTGCCGGTCCAGGCACTGCCGCCGACCGCCGACGATCCCATCGTGGTGGTGGGC
ATGGCCTGCCGTTTCCCCGGTGGTGTGACCTCGCCCGAGGACCTGTGGCGCCTGGTCGAC
GCCGGCACCGACGCCATCACCACCTTCCCGACCAACCGCGGCTGGGACCTCGAATCGCTC
TACGACCCGGACCCCGCACACCTCGGCACCTCCTACACCCGCTCCGGTGGCTTCCTGCAC
GAGGCGGGGGAGTTCGACCCGGCGTTCTTCGGAATGAGCCCGCGTGAGGCGCTGGCAACC
GACTCCCAACAGCGTCTCCTGCTGGAATCCTCCTGGGAGGCGATCGAGCGGGCCGGCATC
GACCCGCTGACCCTGCGCGGCAGCGCCACCGGCGTCTTCGCCGGCGTGATGTACAGCGAC
TACGGGAGCATCCTCGGCGGCAAGGAGTTCGAGGGCTTCCAAGGCCAGGGAAGTGCGGGC
AGCGTGGCCTCGGGCCGCGTCTCCTACACCCTCGGCTTCGAAGGTCCCGCCGTCACCGTG
GATACCGCCTGCTCCTCCTCCCTGGTCGCCCTGCACCTGGCAGCCCAGGCCCTTCGGGCG
GGTGAGTGCACGCTCGCGCTCGCCGGTGGTGTGACGGTGATGTCCACGCCAGGCACGTTC
GTGGAGTTCTCGCGGCAGCGGGGTCTGGCGCCTGATGGTCGTTCCAAGGCGTTCGCCGAG
GCCGCGGACGGCGTCGGCTGGTCCGAGGGCGTCGGCATCCTCGTCCTGGAGCGCCAGTCG
GACGCCGTGCGCAACGGCCACGAGATCCTCGCCGTGATCCGCGGCTCGGCGGTCAACCAG
GACGGTGCGTCCAACGGCCTGACCGCGCCCAACGGCCCGTCCCAGCAGCGCGTCATCCGT
CAGGCGTTGGCCAGTGGCGGCCTGTCCACGGCCGACGTGGACGCCGTCGAGGCGCACGGC
ACGGGTACGACGCTCGGTGACCCGATCGAGGCCCAGGCGCTCCTGGCCACCTACGGCCGC
GACCGCGACCCCGAGAACCCGCTGCTGCTCGGTTCGATCAAGTCCAACCTCGGCCACACC
CAGGCAGCGGCCGGTGTCGCCGGTGTCATCAAGATGGTCATGGCGATGCGGCACGGCGTG
CTGCCGCAGACCCTGCATGTCGACGCGCCGTCCTCGCACGTCGATTGGAGCGTCGGCGCC
GTCGAACTGCTCACCGAGCAGACCGTCTGGCCGGAGACCGGCCGGGTCCGTCGCGCCGGT
GTCTCCTCCTTCGGCATCAGCGGCACCAACGCCCACGTCATCCTGGAACAGCCGGAGGCC
GTGCAGCGCCTGGCACCGGGAGCAGCAGAGACCGTGGAGCCGGTCGCCATCAAGCCGTCG
GCGGAACCGTCCCTGGTGCCGTGGGCGCTGTCCGGCAAGTCACCCGAGGCCCTGCGCGCC
CAGGCCGCACGCCTCCGTGACTTCCTGGCGGAACGGCCCGAACCGCGCTCGATCGACATC
GGCCACTCACTGGCCGTCACACGCTCGCAGTTCGACCACCGCGCGATCGTGCTGGTCGAC
GATGCGAAGGCCCCGGCGGACAGCCTGGCCGCCCTCGCGGCCCTGGCCTCCGGTGTGGCC
GATCCCGCCGTCGTCTCCGACGCGGTATCGACCGGCGGTTCGGCAGTGCTGTTCACAGGT
CAGGGTGCTCAACGTCTGGGCATGGGGCGTGAGTTGTACGGCCGTTTCCCGGTCTTCGCC
GAGGCTCTCGATGTCGTGGTCGACCACCTGGACGCCGCCTTGCCCGCCCAGGCCGGTTTG
CGTGAGGTGATGTGGGGCGACGATGTCGAGTTGCTGAACGAGACGGGTTGGACCCAGCCC
GCGCTCTTCGCCGTCGAGGTGGCGCTGTTCCGGCTGGTGGAGCGTTGGGGTGTCCGTCCG
GACTTCGTGGCCGGTCATTCCATCGGTGAGATCGCGGCGGCGCATGTCGCCGGGGTGTTC
TCGCTGGAGGACGCCTGCCGTCTGGTGGCCGCCCGTGCGACGCTGATGCAGGCGCTGCCG
ACCGGCGGCGCGATGATCGCGGTCCAGGCCACCGAGGACGAAGTGACCCCGCACCTGACC
GACGAGGTGGCGATCGCGGCCGTCAACGGCCCGACCTCCGTGGTGATCTCGGGCGCAGAA
GAGGCCACGCAGACCGTGGCACAACACTTCGCCGACCAGGGGCGCCGGACGACCGCGCTG
CGGGTCTCGCATGCGTTCCACTCGCCGCTGATGGATCCGATGCTGGCGGAGTTCCGTGCG
GTGGCGGAAGGACTGTCCTACGCCACCCCGTCCCTCCCCGTCGTCTCGAATCTGACGGGC
TGGCTGGCCACGGCCGACGAACTGTGCTCGGCCGAGTACTGGGTGCGCCACGTCCGCGAG
GCGGTCCGCTTCGCCGACGGCATCACCACCCTCGAAGCCGAGGGCGTGCGGACCTTCCTG
GAACTCGGCCCGGACGGCATCCTGTCCGCGCTGGCTCAGCAGTCCCTCGCCGGCGAAGCC
GTCACCGTGCCCGTCCTGCGCAAGGACCGCGGTGAGGAGTCCACGGCCCTGACGGCCCGA
GCGCATCTCCACACCCGCGGACTGATCGAAGACTGGCAGGACTTCTTCGCTGGTGTGGGT
GCGGGGCGGGTGGAGTTGCCGACGTATGCGTTCCAGCGTGGGTGGTTCTGGCCGGTTGGT
CGGGTTGGTGTTGGTGGTGATGTGGGTGCTGTGGGGCTTGGGTCTGCGGGGCATCCGTTG
TTGGGTGCTGCGGTGGAGTTGGCTGCGGGTGCGGGGGTGGTGTTGACGGGTCGTCTGTCG
TTGTCGTCGCATGGTTGGTTGGCTGATCATGCGGTGATGGGGCGGGTGTTTGCTCCTGGT
ACGGCGTTGCTGGAGATGGTGATGCGTGCTGGTGATGAGGTGGGGTGTGGTCGTGTTGAG
GAACTGACGTTGGCGGCGCCGTTGGTGTTGCCTGAGCGTGGTGGGGTGCGGGTTCAGGTT
GCTGTGGATGCTCCTGATGCTGCGGGTCGTCGTGGTGTGGGGGTGTATTCGTGTCCTGAT
GGTGTGGGTCAGGCGGTGTGGTCGCAGCATGCTGTCGGTGTGTTGGCCTCTGGTGCGGCT
GACCAGGTCGGTGGGTTCGGTGACGGTGGTGTGTGGCCGCCGCAGGGTGCGGTGTCGGTG
GATGCTGAGGGCTGCTACGAGCTGTTTGCGGATGCTGGGTTCGGTTATGGCCCGGTGTTC
CAGGGGTTGCGTGCGGTGTGGCGTCGCGGCGAGGAACTCTTCGCAGAGGTCGCCCTGTCG
GACGAGGTTGCTGAGAGCGCTGATACGGCGACCGGTTTCGGGTTGCACCCGGCGTTGCTG
GATGCCTCGCTCCATGCCTCGCTTCTCTCCTCCCTTGAAGGTCAATCCGCCGATGGTGGG
CCTGCGTTGCCGTTCGCGTGGGAGGGTGTTTCCCTCTTCGCCTCGGGTGCGACGGCTTTG
CGCGTGCGGTTGGCGCCGGCGGGTGAGCATGCGGTGTCGGTGACCGCGGTGGATCCGACC
GGTGCGCCGGTGATTTCCATCGACGCGCTTCGTACCCGTCGCCTCACCCTCGATGAGGTC
AACGCATCCCACACCCAGCTGAGCGATGCGCTCTTCGGCGTCCAATGGACCACGGTCCCG
AGCACCCCGGCCGCCGACCACCCGTCGGTAGCCATCATCGGAACCGACCCCTTCGGCCTC
GCAGACGGCCTTTCGGACGCCTTGCCCCTGGTCGAGGAGCGCGGTGACCTCGCGGCGCTC
GCAGCGTCGGAGCACCCGGTACCGGACCTCGTCCTCGTCCCGGTAGCGGGCACCCGGCGC
ACAGGCGTACCTGCGGACGCCGAAGGACACACCGACGCCGGGACATCCGACATGCTCCGA
TCCGTGCGTGAGGCCACCGCACAGGTACTGGAGCAGATCCAGCAGTGGTTGGCGGACGAC
CGGTTCGAGGCGGCGCGGCTGGTGTTCGTGACGCGCGGGGCGGTTTCCGTGGGTGAGGGC
GGCATCGCCGACCTGGCGGCCTCGGCCGTCTGGGGTCTGGTGCGGTCGGCGCAGTCGGAG
AATCCGGGCTGCTTCGGTCTTCTCGACCTCGACCTCGACCTCGCCCTTGACTCCGACCTT
GCCCCCGAGGTCGACATCGAGCGCGACCGTGACCGCGATCCGGTCGGTGGGACCGTGCAG
CCCGCGCTCGCCGCGGCCCTGCACGCGACCGCCGACGAGCCGCAGTTGGCACTGCGCGGC
GGGACCGTGCAGGCCGCCCGACTGACCCGAATCCCCGCGCCGCAGACCGACCGTGCCGAG
ACCGACCCTGCCGAGACCGACCGTCCGGAGATCGACACCCGGCGGCCCGGCACGGTGCTC
ATCACCGGTGGTACCGGTGGCCTCGGTGGGTTGCTCGCCCGGCACCTCGTCGCCGAGCGG
GGGGTACGGAGCCTGGTGCTCGCCAGCCGGAGCGGTCTCGCGGCCGAGGGAGCGGAGAAG
CTGGTCGCCGACCTCGAAGCGCTCGGTGCCGTGGTGGCCGTGCAGACGTGTGATGTGGCC
GATGGCGATGCGGTGGCGGCGTTGGTCGCCGGCGTGTCGGACGAGTACCCGCTGACGGCG
GTCGTCCACACGGCCGGTGTGTTGGACGACGGAGTGATCGGCTCGCTCACCGAGGAGCGG
CTCGCCACCGTCCTGCGGCCCAAGGCGGATGCCGCCTGGCATCTGCACGAGGCGACCCGC
GATCTGGACCTGGACGCGTTCGTCGTCTTCTCCTCCCTCGCCGGCGTCCTCGGTGGCGCC
GGTCAGGCCAACTACGCGGCGGCGAACACGTTCCTGGACGCCTTGATGGCGCAGCGTCGC
GCCGCCGGGTTGCCGGGTGTGTCGCTGGCGTGGGGTCCGTGGGACCGGGCCGGCGGCATG
ACGGGGACCCTGTCGGACGCCGAGGCCGACCGCCTCGCCCGCTCCGGTGTTCCGCCGATC
TCGGCGGAGCAGGGCCTTGCGCTGTACGACGCGGCGACCGCCGGTGAGCGGCCGCTGGTG
GTGCCGGTGCGGCTGGACCTCGCCGCGCTCCGCGGGCTCGGTGATGTCCCGGCGCTGCTG
CGCGGACTGGTCCGGACGCCCGCGCGGCGGACCGCGGCGGCCGGTGCGGCGCCGTCGGCC
GATGTGCTCACCCGGCAGTTGGCCGGGCTCGGCGGGGCGGAGCAGGAGGAGGTCCTGCTG
AGGCTGGTGCGCGGTCAGGCCGCGGTGGTGCTCGGGCACGCCGACGGCTCGGCGATCGGT
GCGGGGCGACAGTTCCAGGAGTTGGGCTTCGACTCGCTGACCGCGGTGGAGTTCCGCAAC
CGACTCAACGCGGCCACCGGACTGCGGCTGCCGGCCACCCTGCTGTTCGACTACCCGACG
CCGGCCGACGTCGTCGGGCACCTGCGCGGCCGGCTCGGCACCGGGGAGGTGTCGGGTGCG
GGCTCGGTGCTGGCGGCGCTGGACAACCTTGAGGCGGTGATCGCCGGGCTGTCCCTCGAC
GACGCGGGGGAGCACCAGTTGGTGGCCGGCCGGCTGGAGGTCCTCAGGGCGAAGTGGGCG
GACATGCGAAGCGCGGAGGGAGCTGTGGACGGCGGTGCGGACGTCGACATCGAGGAGGCG
TCGGACGACGACATGTTCGCGCTGCTGGACGACGAGCTGGGGCTGAACTGA
[3] KS35..405
[3] AT545..855
[3] malonyl-CoA730..734
[3] DH903..1067
[3] KR1381..1561
[3] ACP1662..1732
[4] KS1757..2131
[4] AT2289..2600
[4] malonyl-CoA2475..2479
[4] DH2649..2812
[4] KR3124..3304
[4] ACP3407..3477
[5] KS3501..3875
[5] AT4031..4343
[5] malonyl-CoA4218..4222
[5] DH4391..4555
[5] ER4934..5238
[5] KR5248..5428
[5] ACP5524..5598
[6] KS5623..5996
[6] AT6165..6474
[6] malonyl-CoA6352..6356
[6] DH6523..6698
[6] KR7038..7214
[6] ACP7315..7385
[7] KS7408..7782
[7] AT7938..8251
[7] malonyl-CoA8125..8129
[7] DH8299..8464
[7] KR8812..8992
[7] ACP9116..9190
[8] KS9214..9588
[8] AT9757..10067
[8] malonyl-CoA9944..9948
[8] DH10118..10283
[8] KR10657..10837
[8] ACP10935..11009
[3] KS103..1215
[3] AT1633..2565
[3] malonyl-CoA2188..2202
[3] DH2707..3201
[3] KR4141..4683
[3] ACP4984..5196
[4] KS5269..6393
[4] AT6865..7800
[4] malonyl-CoA7423..7437
[4] DH7945..8436
[4] KR9370..9912
[4] ACP10219..10431
[5] KS10501..11625
[5] AT12091..13029
[5] malonyl-CoA12652..12666
[5] DH13171..13665
[5] ER14800..15714
[5] KR15742..16284
[5] ACP16570..16794
[6] KS16867..17988
[6] AT18493..19422
[6] malonyl-CoA19054..19068
[6] DH19567..20094
[6] KR21112..21642
[6] ACP21943..22155
[7] KS22222..23346
[7] AT23812..24753
[7] malonyl-CoA24373..24387
[7] DH24895..25392
[7] KR26434..26976
[7] ACP27346..27570
[8] KS27640..28764
[8] AT29269..30201
[8] malonyl-CoA29830..29844
[8] DH30352..30849
[8] KR31969..32511
[8] ACP32803..33027

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [537-665]  G3DSA:3.40.366.10 [730-841]  G3DSA:3.40.366.10 [2283-2410]  G3DSA:3.40.366.10 [2475-2590]  G3DSA:3.40.366.10 [4023-4153]  G3DSA:3.40.366.10 [4218-4333]  G3DSA:3.40.366.10 [6160-6287]  G3DSA:3.40.366.10 [6352-6465]  G3DSA:3.40.366.10 [7933-8060]  G3DSA:3.40.366.10 [8125-8238]  G3DSA:3.40.366.10 [9753-9879]  G3DSA:3.40.366.10 [9944-10059]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [7038-7201]  2.8e-56 PF00106 [10657-10824]  1.29999999999998e-59 PF00106
PF00106   adh_short
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [5063-5084]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [1690-1705]  PS00012 [3435-3450]  PS00012 [5556-5571]  PS00012 [7343-7358]  PS00012 [9148-9163]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1659-1735]  G3DSA:1.10.1200.10 [3405-3480]  G3DSA:1.10.1200.10 [5525-5601]  G3DSA:1.10.1200.10 [7312-7388]  G3DSA:1.10.1200.10 [9117-9193]  G3DSA:1.10.1200.10 [10938-11013]  G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1662-1732]  PS50075 [3407-3477]  PS50075 [5524-5598]  PS50075 [7315-7385]  PS50075 [9116-9190]  PS50075 [10935-11009]  PS50075
PS50075   ACP_DOMAIN
 [1665-1731]  1.1e-12 PF00550 [3411-3476]  8.1e-13 PF00550 [5532-5597]  5.40000000000001e-11 PF00550 [7319-7384]  2.1e-11 PF00550 [9124-9189]  3.4e-11 PF00550 [10943-11008]  9.8e-11 PF00550
PF00550   PP-binding
 [1655-1773]  8.20001307135067e-31 SSF47336 [3400-3517]  1.50000306971104e-28 SSF47336 [5521-5639]  8.70001261213514e-28 SSF47336 [7308-7424]  9.90001804798395e-31 SSF47336 [9113-9230]  2.90000354677981e-28 SSF47336 [10930-11016]  1.89999859865865e-22 SSF47336
SSF47336   ACP_like
IPR011032 GroES-like (Domain)
 [4928-5081]  1.20000117458134e-32 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [5074-5170]  1.2e-17 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [4954-5014]  2.9e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1381-1560]  6.29999999999997e-63 PF08659 [3124-3303]  1.80000000000002e-63 PF08659 [5248-5427]  1.80000000000002e-63 PF08659 [8812-8991]  8.39999999999977e-66 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-282]  5.00000000000001e-89 PF00109 [1757-2005]  9.2000000000001e-93 PF00109 [3501-3749]  6.10000000000004e-93 PF00109 [5623-5871]  4.80000000000003e-91 PF00109 [7408-7656]  1.39999999999997e-94 PF00109 [9214-9462]  5.30000000000001e-93 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [290-405]  1.70000000000001e-45 PF02801 [2013-2131]  1.80000000000002e-47 PF02801 [3757-3875]  4.2e-48 PF02801 [5879-5996]  2.59999999999998e-46 PF02801 [7664-7782]  8.79999999999995e-48 PF02801 [9470-9588]  3.80000000000003e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [545-855]  8.19999999999987e-68 PF00698 [2289-2600]  5.99999999999995e-68 PF00698 [4031-4343]  1.69999999999998e-65 PF00698 [6165-6474]  2.29999999999998e-64 PF00698 [7938-8251]  5.30000000000001e-62 PF00698 [9757-10067]  9.20000000000002e-62 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [540-847]  1.59998835313644e-74 SSF52151 [2286-2569]  6.40004254961849e-76 SSF52151 [4026-4335]  5.60004908290974e-76 SSF52151 [6161-6449]  9.09992432541739e-71 SSF52151 [7933-8242]  3.49999466863949e-74 SSF52151 [9755-10061]  7.49999605851445e-73 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [667-729]  3.49999466863949e-17 SSF55048 [2412-2474]  4.49999046578037e-17 SSF55048 [4155-4217]  4.30000170645867e-16 SSF55048 [6289-6351]  1.09999909120787e-16 SSF55048 [8062-8124]  5.50000546509999e-15 SSF55048 [9881-9943]  5.79999653854781e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [35-292]  G3DSA:3.40.47.10 [294-458]  G3DSA:3.40.47.10 [1759-2017]  G3DSA:3.40.47.10 [2018-2182]  G3DSA:3.40.47.10 [3503-3761]  G3DSA:3.40.47.10 [3762-3925]  G3DSA:3.40.47.10 [5625-5883]  G3DSA:3.40.47.10 [5884-6048]  G3DSA:3.40.47.10 [7410-7668]  G3DSA:3.40.47.10 [7669-7833]  G3DSA:3.40.47.10 [9216-9474]  G3DSA:3.40.47.10 [9475-9640]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-404]  5.79999653854781e-101 SSF53901 [1749-2129]  1.39999277195148e-100 SSF53901 [3493-3873]  8.29994113369276e-103 SSF53901 [5622-5993]  4.10001399699315e-100 SSF53901 [7400-7834]  8.19994104549873e-102 SSF53901 [9206-9586]  8.60006330213929e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1381-1567]  G3DSA:3.40.50.720 [3122-3310]  G3DSA:3.40.50.720 [5071-5165]  5.40000000000002e-20 G3DSA:3.40.50.720 [5248-5434]  G3DSA:3.40.50.720 [7039-7221]  G3DSA:3.40.50.720 [8811-8998]  G3DSA:3.40.50.720 [10657-10841]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [195-211]  PS00606 [1918-1934]  PS00606 [3662-3678]  PS00606 [5784-5800]  PS00606 [7569-7585]  PS00606 [9375-9391]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [545-836]  SM00827 [2290-2581]  2.0000139277205e-127 SM00827 [4031-4324]  6.40004254961849e-124 SM00827 [6165-6456]  8.10000734323267e-120 SM00827 [7938-8231]  3.79997359309399e-122 SM00827 [9757-10050]  8.50003024809048e-122 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1663-1735]  1.10000150671643e-35 SM00823 [3408-3480]  2.800005042611e-32 SM00823 [5529-5601]  2.60000517657733e-35 SM00823 [7316-7388]  1.29999924468179e-31 SM00823 [9121-9193]  1.40000506907309e-33 SM00823 [10940-11012]  3.49999466863949e-33 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [903-1067]  3.79997359309399e-90 SM00826 [2649-2812]  4.10001399699315e-87 SM00826 [4391-4555]  2.59998233910302e-87 SM00826 [6523-6698]  6.29998179434741e-86 SM00826 [8299-8464]  2.2999842048857e-82 SM00826 [10118-10283]  1e-81 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-458]  SM00825 [1759-2183]  SM00825 [3503-3927]  SM00825 [5625-6049]  SM00825 [7410-7834]  SM00825 [9216-9640]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1381-1561]  1.79999754022378e-66 SM00822 [3124-3304]  6.4999795054176e-59 SM00822 [5248-5428]  6.4999795054176e-59 SM00822 [7038-7214]  1.10000150671643e-53 SM00822 [8812-8992]  5.60004908290974e-68 SM00822 [10657-10837]  1e-65 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [4934-5238]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit