close all open/close all

CDS information : Nysta_00160


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction110,113 / 110,868 / + [in whole cluster]
110,113 / 110,868 / + [in contig]
Location110113..110868 [in whole cluster]
110113..110868 [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)NysE
Gene
Gene (GenBank)nysE
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • putative thioesterase
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
Related Reference
ACC
Q6W5Q5
NITE
FR008_00110
PmId
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative type II thioesterase [NysE]
MTTSTEESLWARCFHPAPAAPVRLFCFPHAGGSASFYFPVSAQLSSVAEVFAIQYPGRQD
RRKEAGVSDLATLADQVYDALRPLLKERPSTFFGHSMGATLAFEVARRFEADDGDLVRLF
ASGRRAPSRVREEAVHRRSDDGIVEELKLLAGTNTALLGDEEILRMILPAIRSDYQAIET
YRCPPDVTVRAPLTVLTGDRDPKTSLDEAEAWRGHTTGDFDLKVLPGGHFFVSSEAPAII
DLLRAHLAGNG
selected fasta
>putative type II thioesterase [NysE]
ATGACCACGTCCACCGAGGAGAGCCTGTGGGCCCGGTGCTTCCATCCAGCACCGGCCGCC
CCCGTCCGGCTCTTCTGTTTCCCACATGCGGGCGGCTCGGCCTCCTTCTACTTCCCGGTG
TCGGCCCAACTGTCCTCGGTTGCCGAGGTGTTCGCCATCCAGTACCCGGGGCGCCAGGAC
CGGCGCAAGGAAGCCGGTGTCAGTGACCTCGCGACCTTGGCCGACCAGGTCTACGACGCG
CTGCGCCCCCTGCTGAAGGAGCGGCCGAGCACGTTCTTCGGGCACAGCATGGGCGCGACG
CTGGCCTTCGAGGTGGCCCGGCGCTTCGAGGCCGACGACGGTGACCTGGTCCGGCTGTTC
GCCTCCGGGCGCCGGGCCCCCTCCCGCGTGCGTGAAGAGGCCGTGCACCGGCGGTCCGAC
GACGGCATCGTCGAGGAGCTGAAGCTGCTCGCCGGCACCAACACCGCGCTGCTCGGCGAC
GAGGAGATCCTGCGGATGATCCTGCCCGCGATCCGCAGCGACTACCAGGCCATCGAGACC
TACCGCTGCCCGCCCGACGTCACCGTCCGGGCGCCGCTGACCGTCCTCACCGGCGACCGC
GACCCGAAGACCTCCCTGGACGAGGCCGAGGCGTGGCGCGGCCACACCACCGGGGACTTC
GACCTCAAGGTGCTTCCCGGTGGGCACTTCTTCGTCAGCTCCGAGGCCCCGGCGATCATC
GATCTGCTCCGGGCGCACCTCGCCGGCAACGGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [23-243]  2.50000000000001e-58 PF00975
PF00975   Thioesterase
SignalP
 [1-42]  0.281 Signal
Bacteria, Gram-negative   
 [1-33]  0.172 Signal
Eukaryota   
TMHMM No significant hit