close all open/close all

CDS information : Nysta_00200


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction120,268 / 120,900 / + [in whole cluster]
120,268 / 120,900 / + [in contig]
Location120268..120900 [in whole cluster]
120268..120900 [in contig]
TypeCDS
Length633 bp (210 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional regulator
Product (GenBank)ORF4
GenenysRIV
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • putative transcriptional regulator
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[14973031] In vivo analysis of the regulatory genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455 reveals their differential control over antibiotic biosynthesis. (J Bacteriol. , 2004)

close this sectionSequence

selected fasta
>LuxR family transcriptional regulator [ORF4]
MISAQTAPAGESVGPGLMASLDRDLTIKHANQEFRRRFDDSAGDVCGRSFRDLMHPSVQQ
PLMRQFSRLIEGKRHRFASHVVAVGAQDAAFAGTLTASAVTGKTPDIAGILVLMDSSGAA
DAADAGVVTSQKKFLTEIDARILEGIAAGLSTIPLASRLYLSRQGVEYHVTGLLRKLRVP
NRAALVSRAYSMGILNVGTWPPKVVDDFIK
selected fasta
>LuxR family transcriptional regulator [ORF4]
GTGATATCCGCTCAGACCGCACCGGCCGGGGAGTCCGTCGGCCCCGGGCTGATGGCGTCC
CTCGACCGTGACCTCACCATCAAGCACGCCAACCAGGAGTTCCGCCGCCGCTTCGACGAT
TCCGCCGGTGACGTCTGCGGTCGCAGCTTCCGGGACCTGATGCACCCGAGCGTGCAGCAG
CCGCTGATGCGCCAGTTCTCCCGGCTGATCGAGGGCAAGCGGCACCGCTTCGCCTCGCAC
GTGGTCGCCGTGGGCGCCCAGGACGCGGCCTTCGCGGGCACCCTCACCGCCTCCGCGGTC
ACCGGCAAGACCCCGGACATCGCCGGGATCCTGGTGCTCATGGACTCGTCCGGCGCCGCC
GACGCCGCCGATGCCGGCGTCGTGACCAGCCAGAAGAAGTTCCTGACCGAGATCGATGCG
CGCATCCTCGAAGGCATCGCGGCCGGGCTGTCGACCATTCCGCTCGCCTCGCGGCTCTAC
CTCAGCCGCCAGGGCGTGGAGTACCACGTCACCGGGCTGCTGCGGAAGTTGCGGGTGCCC
AACCGCGCCGCGCTCGTCTCGCGCGCCTACTCCATGGGCATCCTGAACGTCGGCACCTGG
CCCCCGAAGGTCGTGGACGACTTCATCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000014 PAS domain (Domain)
 [4-71]  3.6000003870074e-06 SM00091
SM00091   PAS
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [135-188]  8.60000000000001e-09 PF00196
PF00196   GerE
 [132-189]  6.40000038788486e-09 SM00421
SM00421   HTH_LUXR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [115-196]  1.3e-12 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR013656 PAS fold-4 (Domain)
 [16-88]  1.3e-09 PF08448
PF08448   PAS_4
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [113-199]  1e-12 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit