close all open/close all

CDS information : Nysta_00210


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction121,589 / 122,350 / + [in whole cluster]
121,589 / 122,350 / + [in contig]
Location121589..122350 [in whole cluster]
121589..122350 [in contig]
TypeCDS
Length762 bp (253 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transcriptional regulator
Product (GenBank)ORF3
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in nystatin biosynthesis.
Note (GenBank)
  • putative repressor
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[14973031] In vivo analysis of the regulatory genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455 reveals their differential control over antibiotic biosynthesis. (J Bacteriol. , 2004)
Related Reference
ACC
P0ACL0
PmId
[8955387] Repressor for the sn-glycerol 3-phosphate regulon of Escherichia coli K-12: primary structure and identification of the DNA-binding domain. (J Bacteriol. , 1996)
[3045764] Nucleotide sequence of the glpR gene encoding the repressor for the glycerol-3-phosphate regulon of Escherichia coli K12. (Nucleic Acids Res. , 1988)

close this sectionSequence

selected fasta
>putative transcriptional regulator [ORF3]
MDAEGRRRDMLELIRRSGSADVVRLAEEFAVSKETVRRDLNVLEGHGLIRRRHGGAYPMV
RPGSEAVFVSRTAQPIPEESRIATAAAELLSEAETVFIDEGFTPQLIADALPRDRPLTIV
TASLPVVSAFATSPQANVLLLGGRVRRGTTATVDHWAVHMLSGFVIDLAFLGAEGISRRY
GLTTPDPAVAEVKAQAIRVARRPVLAGVHTKFGTASFCRFGEVGDLETIVTGAGLPVAEA
HRYHLMGPKVLRV
selected fasta
>putative transcriptional regulator [ORF3]
GTGGATGCTGAGGGCCGCCGCAGGGACATGCTGGAGCTGATCCGGCGCAGCGGATCCGCC
GATGTCGTGCGTCTCGCCGAGGAGTTCGCCGTCAGCAAGGAAACGGTCCGCCGGGACCTG
AACGTCCTGGAGGGCCATGGGCTGATACGGCGGCGGCACGGTGGCGCCTATCCCATGGTG
CGGCCGGGCTCCGAGGCCGTCTTCGTCTCCCGGACCGCACAGCCGATCCCGGAGGAGTCC
CGGATCGCCACCGCGGCCGCCGAACTCCTCAGCGAGGCCGAGACGGTCTTCATCGACGAG
GGCTTCACCCCGCAACTCATCGCCGACGCCCTGCCGCGCGACCGGCCGCTGACCATCGTC
ACCGCCTCGCTCCCGGTGGTCAGCGCCTTCGCGACGAGCCCACAGGCCAACGTGCTGCTC
CTGGGCGGCCGGGTCCGCCGGGGCACGACGGCCACCGTCGACCACTGGGCCGTCCACATG
CTGTCCGGCTTCGTCATCGACCTGGCCTTCCTCGGCGCGGAGGGGATCTCGCGCAGGTAC
GGCCTGACCACCCCCGACCCGGCGGTCGCCGAGGTCAAGGCCCAGGCCATCCGCGTCGCG
CGCCGCCCGGTCCTCGCCGGGGTGCACACCAAGTTCGGCACGGCGAGCTTCTGCCGGTTC
GGAGAGGTGGGCGACCTGGAGACGATCGTCACCGGCGCCGGCCTGCCCGTCGCCGAGGCC
CACCGCTACCACCTCATGGGCCCCAAGGTTTTACGGGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001034 HTH DeoR N-terminal domain (Domain)
 [3-58]  PS51000
PS51000   HTH_DEOR_2
 [6-56]  1.1e-16 PF08220
PF08220   HTH_DeoR
 [24-38]  3.1999989904635e-10 PR00037 [38-56]  3.1999989904635e-10 PR00037
PR00037   HTHLACR
 [6-58]  5.50000546509999e-16 SM00420
SM00420   HTH_DEOR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [7-57]  1.8e-10 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR014036 DeoR C-terminal sensor domain (Domain)
 [78-232]  2.50000000000001e-42 PF00455
PF00455   DeoRC
IPR018356 Transcription regulator, HTH DeoR-type, conserved site (Conserved_site)
 [6-40]  PS00894
PS00894   HTH_DEOR_1
SignalP No significant hit
TMHMM No significant hit