close all open/close all
Nysta_00210 Nysta_00210   last last

CDS information : Nysta_00220


close this sectionLocation

Organism
StrainATCC 11455 (=NBRC 15452)
Entry nameNystatin
Contig
Start / Stop / Direction123,468 / 122,404 / - [in whole cluster]
123,468 / 122,404 / - [in contig]
Locationcomplement(122404..123468) [in whole cluster]
complement(122404..123468) [in contig]
TypeCDS
Length1,065 bp (354 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transcriptional regulator
Product (GenBank)ORF2
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in nystatin biosynthesis.
Note (GenBank)
  • putative transcriptional regulator
Reference
ACC
PmId
[10873841] Biosynthesis of the polyene antifungal antibiotic nystatin in Streptomyces noursei ATCC 11455: analysis of the gene cluster and deduction of the biosynthetic pathway. (Chem Biol. , 2000)
[14973031] In vivo analysis of the regulatory genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455 reveals their differential control over antibiotic biosynthesis. (J Bacteriol. , 2004)
Family/Domain
FD
IPR019888

close this sectionSequence

selected fasta
>putative transcriptional regulator [ORF2]
MAQDSGQTPRSLDHVDQALVHALQITPRASWTRIGSVLGLDAVTVARRWNRLVETGAAWI
SCHPAPVLAASGQGCLAFVEIDCAPGRLLDVARALAAAPHVVALSHVTGDRDLQLNVMAR
DPAMLSRWVTHDLAALDGVRAARTHLAGPVHTEGSRWRLRALGRHQVARLAADASRHRTD
TPAFVLDELDQQLVTALSVDGRATYRALAEQCGAGPDTVRRRVQRLFAADMLHARCEVAR
PLSEWPVTVSFWGQVPAARLREVTRRVTGMREVRLCASVISRHNLHLVAWVRSLDDAQRF
EVRLAERAADLTVTERAVALWHMKHGGHLLDEEGYRVGVTPLALWREPTDARRG
selected fasta
>putative transcriptional regulator [ORF2]
GTGGCGCAGGATTCCGGGCAGACCCCCCGGTCCCTGGACCATGTGGATCAGGCCCTGGTG
CACGCGCTGCAGATCACGCCGCGGGCCAGCTGGACCCGGATCGGCTCCGTCCTCGGACTG
GACGCCGTGACGGTGGCCAGGCGCTGGAACCGGCTGGTCGAGACCGGCGCCGCCTGGATC
AGCTGCCATCCGGCCCCGGTGCTGGCCGCGTCGGGCCAGGGGTGCCTGGCGTTCGTCGAG
ATCGACTGCGCTCCCGGCCGACTGCTCGACGTCGCGCGGGCGTTGGCCGCCGCGCCGCAC
GTGGTGGCGCTCTCCCACGTCACCGGGGACCGTGACCTCCAACTCAACGTCATGGCCCGC
GATCCGGCCATGCTCTCCCGTTGGGTGACCCACGACCTCGCCGCGTTGGACGGCGTCCGG
GCCGCCCGGACGCACCTGGCCGGCCCGGTGCACACCGAGGGCAGCCGGTGGCGCCTGCGG
GCCCTCGGCCGGCACCAGGTCGCCCGGCTCGCCGCCGACGCGTCCAGACACCGCACGGAC
ACCCCCGCCTTCGTCCTCGACGAGCTCGACCAACAGCTGGTCACCGCGCTGTCCGTGGAC
GGCCGGGCCACCTACCGCGCGCTGGCCGAGCAGTGCGGCGCCGGCCCCGACACCGTGCGC
CGTCGCGTCCAACGGCTCTTCGCCGCGGACATGTTGCACGCCCGGTGCGAGGTCGCCCGC
CCGCTGTCCGAGTGGCCGGTCACGGTGAGCTTCTGGGGGCAGGTCCCGGCCGCGAGGCTG
CGCGAGGTGACCCGCCGGGTCACCGGGATGCGCGAGGTCCGCCTGTGCGCGAGCGTCATC
AGCCGGCACAACCTGCACCTGGTGGCCTGGGTGCGCTCCCTCGACGACGCCCAGCGCTTC
GAGGTCCGACTCGCCGAACGGGCCGCGGACCTGACCGTCACCGAACGCGCGGTCGCCCTC
TGGCACATGAAGCACGGCGGCCATCTCCTCGACGAGGAGGGCTACCGGGTGGGGGTGACA
CCGCTCGCACTCTGGCGGGAACCGACGGACGCGCGACGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000485 HTH transcription regulator AsnC-type DNA-binding domain (Domain)
 [186-202]  6.80000200614765e-07 PR00033 [202-213]  6.80000200614765e-07 PR00033 [213-232]  6.80000200614765e-07 PR00033
PR00033   HTHASNC
IPR011008 Dimeric alpha-beta barrel (Domain)
 [73-159]  6.20000124972815e-15 SSF54909 [245-329]  1.6999992228405e-06 SSF54909
SSF54909   Dimer_A_B_barrel
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [10-56]  1.99999999999999e-22 G3DSA:1.10.10.10 [186-231]  1.99999999999999e-22 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR019887 Transcription regulator AsnC-type, C-terminal (Domain)
 [77-147]  2.1e-21 G3DSA:3.30.70.920
G3DSA:3.30.70.920   G3DSA:3.30.70.920
 [79-146]  2.6e-11 PF01037
PF01037   AsnC_trans_reg
IPR019888 Transcription regulator AsnC-type (Family)
 [12-119]  1.39999892049878e-10 SM00344 [186-291]  2.50000086445942e-07 SM00344
SM00344   HTH_ASNC
SignalP No significant hit
TMHMM No significant hit
Nysta_00210 Nysta_00210   last last