close all open/close all
first first   Oligo_00020 Oligo_00020

CDS information : Oligo_00010


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction1,134 / 1 / - [in whole cluster]
1,134 / 1 / - [in contig]
Locationcomplement(1..1134) [in whole cluster]
complement(1..1134) [in contig]
TypeCDS
Length1,134 bp (377 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)mcmA
EC number
Keyword
Note
Note (GenBank)
  • methylmalonyl-CoA mutase
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein
MTGYSTAADANARFRQLVGSGTRAVPVVFDLPTRAGLDSDAPAARGLVGRRGVAVDSIDD
MRVLFGGLRLDRVVPSLAVDAPAAPLLVLYQLVAEEHGAPAQRLAGAVRGDVFKEFLARG
PGVFPLRPSLRLAMNVFAYCQAELPRWQCLSVCGHHLAGTGADPALEVAFTVAGGIEYLR
AAVTAGLDVRTVAPRLTLCLVGGTTGRENRAKLRATRRVWTRTANERFGSGRTAPRLYVR
TPRDGLATLACTEDIEAGATALVDRIERLGGTLTVLEHGLAGQLLGRPHGDRPATPRPHP
PHQDSLDLQARQTERLAKLRAWRVQPAVDEALLRLRKAAQGDDNVLYPMREALAARATVG
EVCDALRSTWGTGPSAT
selected fasta
>hypothetical protein
ATGACCGGCTACAGCACCGCCGCGGACGCCAACGCACGGTTCCGGCAGCTGGTCGGCAGC
GGCACCCGGGCCGTACCGGTCGTCTTCGACCTGCCGACGCGCGCCGGACTCGACTCCGAC
GCGCCGGCGGCGCGCGGACTGGTCGGCCGGCGCGGGGTGGCCGTCGACTCGATCGACGAC
ATGCGGGTGCTCTTCGGCGGGCTCCGCCTGGACCGGGTCGTCCCGTCGCTGGCCGTCGAC
GCCCCGGCGGCCCCCCTCCTCGTCCTCTACCAGCTGGTCGCCGAGGAGCACGGGGCACCG
GCCCAGCGGCTGGCGGGGGCGGTCCGGGGCGACGTCTTCAAGGAGTTCCTCGCCCGCGGG
CCCGGCGTCTTCCCGCTGCGGCCGTCCCTCCGTCTTGCCATGAACGTGTTCGCCTACTGC
CAGGCCGAGCTGCCGCGCTGGCAGTGCCTGTCCGTGTGCGGCCACCATCTGGCCGGGACC
GGCGCGGACCCGGCGCTGGAGGTCGCCTTCACCGTCGCCGGCGGCATCGAGTACCTGCGC
GCGGCCGTGACGGCGGGCCTGGACGTGCGGACCGTCGCACCGCGCCTGACGCTCTGCCTC
GTCGGCGGCACCACCGGCCGCGAGAACCGGGCCAAGCTACGGGCGACGCGCCGGGTGTGG
ACCAGGACGGCGAACGAGCGCTTCGGTTCGGGCCGGACCGCACCGCGCCTGTACGTCCGG
ACCCCCCGGGACGGCTTGGCCACCCTGGCGTGCACGGAGGACATCGAGGCCGGGGCGACC
GCTCTGGTGGACCGGATCGAACGGCTCGGCGGGACGCTCACGGTCCTCGAACACGGCCTG
GCCGGCCAACTGCTCGGCCGGCCCCACGGCGACCGGCCCGCCACGCCCCGGCCGCACCCG
CCGCACCAGGACTCCCTCGACCTCCAGGCCCGGCAGACGGAGCGGCTGGCCAAGCTGCGC
GCGTGGCGCGTCCAGCCCGCCGTCGACGAGGCCCTGCTACGGCTGCGGAAGGCCGCACAG
GGCGACGACAACGTTCTCTACCCCATGCGGGAGGCGCTGGCGGCCAGGGCCACGGTGGGC
GAGGTCTGCGACGCCCTGCGCTCGACGTGGGGGACGGGCCCCAGCGCCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006099 Methylmalonyl-CoA mutase, alpha/beta chain, catalytic (Domain)
 [2-232]  2.80000000000001e-58 PF01642 [310-371]  9.39999999999999e-07 PF01642
PF01642   MM_CoA_mutase
IPR014348 Cobalamin (vitamin B12)-dependent enzyme, catalytic subdomain (Domain)
 [3-238]  1.39999999999997e-83 G3DSA:3.20.20.240 [301-372]  1.39999999999997e-83 G3DSA:3.20.20.240
G3DSA:3.20.20.240   Cobalamin-dep_enz_cat
IPR016176 Cobalamin (vitamin B12)-dependent enzyme, catalytic (Domain)
 [3-374]  6.19996040581186e-85 SSF51703
SSF51703   Cbl-dep_enz_cat
SignalP No significant hit
TMHMM No significant hit
first first   Oligo_00020 Oligo_00020