close all open/close all

CDS information : Oligo_00020


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction1,886 / 1,131 / - [in whole cluster]
1,886 / 1,131 / - [in contig]
Locationcomplement(1131..1886) [in whole cluster]
complement(1131..1886) [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative phosphopantetheinyl transferase
Product (GenBank)phosphopantheteinyl transferase
Gene
Gene (GenBank)pptA
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)
Related Reference
ACC
Q6T709
PmId
[14695521] Identification of a phosphopantetheinyl transferase for erythromycin biosynthesis in Saccharopolyspora erythraea. (Chembiochem. , 2004)
ACC
Q9F0Q6
PmId
[11451672] Cloning and characterization of a phosphopantetheinyl transferase from Streptomyces verticillus ATCC15003, the producer of the hybrid peptide-polyketide antitumor drug bleomycin. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase [phosphopantheteinyl transferase]
MRAHEVFADVPVSSLHPREAALVQDAVESRRREFATGRHCARRALASLGVPPGPLLATPR
GAPRWPAGVCGAITHCAGYRAAAVARAPGIRAVGIDAEPDRPLPEGVLEAVALPAEQFQV
KEHTARHPGVVWGKLLFSAKESVYKAWFPATGRPLGFEEALIDLDPVSSTFRVRVLPTAL
RAAEPELRDLHGRWLVRHGIIVTAVVVDGPGRDTPHAPSPYDRTKHSAPTGRSADRPGGR
PTDRATDRPTA
selected fasta
>putative phosphopantetheinyl transferase [phosphopantheteinyl transferase]
GTGCGGGCGCACGAGGTCTTCGCCGACGTCCCGGTCTCCTCGCTGCACCCCCGGGAGGCC
GCCCTCGTCCAGGACGCCGTGGAGAGCCGCCGCCGGGAGTTCGCGACCGGCCGGCACTGC
GCACGCCGGGCACTGGCCTCGCTCGGCGTCCCGCCCGGCCCGCTGCTCGCCACCCCGAGG
GGCGCACCCCGCTGGCCCGCCGGTGTGTGCGGAGCGATCACCCACTGCGCCGGGTACCGC
GCCGCCGCCGTCGCCCGCGCCCCCGGCATCAGGGCCGTCGGCATCGACGCGGAGCCCGAC
CGGCCGCTTCCGGAGGGAGTCCTGGAGGCCGTCGCGCTGCCCGCGGAGCAGTTCCAGGTC
AAGGAGCACACGGCCCGGCACCCCGGTGTCGTCTGGGGAAAGCTGCTGTTCAGCGCGAAG
GAGAGCGTCTACAAGGCGTGGTTCCCGGCGACCGGGCGGCCCCTGGGCTTCGAGGAGGCC
CTGATCGACCTCGACCCCGTCAGCAGCACCTTCCGCGTACGGGTGCTCCCCACCGCCCTG
CGCGCGGCCGAGCCGGAGCTGCGGGACCTTCACGGCCGCTGGCTCGTCCGGCACGGGATC
ATCGTCACGGCGGTCGTGGTGGACGGCCCCGGCCGGGACACACCGCACGCCCCGTCGCCG
TACGACCGTACGAAGCACTCCGCGCCCACCGGCCGTTCCGCCGACCGGCCCGGCGGCCGG
CCCACCGACCGCGCCACCGACCGCCCCACCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003542 Enterobactin synthetase-like, component D (Family)
 [28-48]  7.40000780398343e-23 PR01399 [58-76]  7.40000780398343e-23 PR01399 [135-151]  7.40000780398343e-23 PR01399
PR01399   ENTSNTHTASED
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [90-166]  9.9e-07 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
 [89-209]  1.49999977583352e-14 SSF56214
SSF56214   4-PPT_transf
 [93-168]  9.7e-11 PF01648
PF01648   ACPS
SignalP No significant hit
TMHMM No significant hit