close all open/close all

CDS information : Oligo_00030


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction2,875 / 1,910 / - [in whole cluster]
2,875 / 1,910 / - [in contig]
Locationcomplement(1910..2875) [in whole cluster]
complement(1910..2875) [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase
Product (GenBank)SimX4 homolog
Gene
Gene (GenBank)simX4 homolog
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)
Family/Domain
FD
IPR004843

close this sectionSequence

selected fasta
>putative hydrolase [SimX4 homolog]
MSQDRHDGSTAALGGPSHGGRLLAVSDIHVRHRQNRDIVQDLHPGCAEDWLIVAGDVAES
VADITWALSLLRDRFAKVIWAPGNHELWTAPGDPDELRGERKYRHLVDLCRALGVVTPED
PYPVWHGAGGPVAVAPLFLLYDYSFLPPGAWSKSHALRLADDAGVICTDEFLLHPDPYPS
REAWCRARVRATRARLDALPDDLPTVLVNHFPLVREPTRVLRHPEFALWCGTTATADWHL
RYRAAAVVHGHLHIPRTIRCDDVPHHEVSLGYPREWQRYGRRPDWPVQILTPAPAPAPAP
VPVPVPAPPGHRTASPADRRP
selected fasta
>putative hydrolase [SimX4 homolog]
GTGAGCCAGGACAGGCACGACGGCTCCACCGCCGCTCTCGGCGGCCCCTCCCACGGCGGC
CGGCTCCTGGCCGTCAGCGACATCCACGTACGCCACCGACAGAACCGGGACATCGTCCAG
GACCTGCACCCGGGCTGTGCCGAGGACTGGCTCATCGTCGCCGGAGACGTGGCCGAGAGC
GTGGCCGACATCACCTGGGCGCTCTCCCTGCTCCGGGACCGGTTCGCCAAGGTGATCTGG
GCGCCCGGCAACCACGAGCTGTGGACCGCGCCCGGCGACCCCGACGAACTGCGCGGCGAG
CGCAAGTACCGGCACCTGGTGGACCTCTGCCGCGCCCTGGGAGTCGTCACCCCAGAGGAC
CCCTACCCCGTCTGGCACGGCGCGGGCGGTCCCGTGGCCGTCGCACCGCTCTTCCTCCTC
TACGACTACAGCTTCCTGCCCCCGGGAGCCTGGTCGAAGAGCCACGCGCTGCGCCTGGCC
GACGACGCCGGCGTGATCTGCACCGACGAGTTCCTGCTCCACCCGGACCCCTACCCGAGC
CGTGAGGCCTGGTGCCGGGCCAGGGTGAGGGCCACCCGGGCCAGGCTCGACGCCCTGCCG
GACGACCTGCCCACCGTCCTGGTCAACCACTTCCCGCTGGTCCGGGAGCCCACCCGCGTC
CTCCGGCACCCCGAGTTCGCCCTGTGGTGCGGCACCACGGCGACGGCGGACTGGCACCTC
CGGTACCGGGCGGCCGCGGTCGTCCACGGGCATCTGCACATTCCCCGGACGATCCGCTGC
GACGACGTACCGCACCACGAGGTGTCCCTCGGCTACCCGCGGGAGTGGCAGCGGTACGGC
CGGCGCCCGGACTGGCCGGTCCAGATCCTGACACCGGCACCGGCACCGGCACCGGCACCC
GTGCCCGTACCCGTACCGGCACCGCCGGGCCACCGGACCGCGTCACCCGCGGACCGACGG
CCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004843 Metallophosphoesterase domain (Domain)
 [21-255]  3.60000000000001e-16 PF00149
PF00149   Metallophos
SignalP No significant hit
TMHMM No significant hit