close all open/close all

CDS information : Oligo_00040


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction3,213 / 3,971 / + [in whole cluster]
3,213 / 3,971 / + [in contig]
Location3213..3971 [in whole cluster]
3213..3971 [in contig]
TypeCDS
Length759 bp (252 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)thioesterase
Gene
Gene (GenBank)olmC
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase]
MSANRVDGNLWVRQFHPAPTAATKLVCLPHAGGSASYFLPVSKALAPGVDVLAIQYPGRQ
DRRHEKCIDNIAELADAVTAVLEPLADRPLVLFGHSMGATLAFEVALRLERKGIVPLALF
ASGRRAPSRHRDESVHLRGDDEIIAELKTLSGTRSEVLGDEEILRMVLPAIRSDYKAAET
YRYAGGARLTAPIHAHFGVEDPRVSLDEAQAWADHTTGHFELRSHPGGHFYLNDQAPRVI
EEIARVSSSVAS
selected fasta
>putative type II thioesterase [thioesterase]
GTGAGTGCCAACCGCGTTGACGGGAACCTGTGGGTCCGCCAGTTCCACCCGGCGCCGACC
GCGGCCACAAAGCTCGTCTGCCTCCCACACGCTGGTGGATCCGCCTCGTACTTCCTGCCC
GTTTCGAAGGCGCTGGCTCCCGGCGTCGACGTACTCGCCATCCAGTACCCGGGGCGGCAG
GACCGGCGCCACGAGAAGTGCATCGACAACATCGCCGAGCTGGCCGACGCCGTGACGGCC
GTACTGGAGCCCCTGGCCGACCGGCCGCTGGTGCTGTTCGGCCACAGCATGGGGGCCACC
CTCGCGTTCGAGGTGGCCCTGCGGCTGGAGCGGAAGGGCATCGTGCCCCTCGCGCTGTTC
GCCTCGGGCCGGCGGGCTCCTTCGCGCCACCGTGACGAGAGCGTGCATCTGCGCGGCGAC
GACGAGATCATCGCCGAGCTGAAGACGCTGAGCGGGACGCGGTCCGAGGTGCTCGGGGAC
GAGGAGATCCTGCGCATGGTGCTGCCCGCCATCCGCAGCGACTACAAGGCGGCCGAGACC
TATCGGTACGCCGGCGGGGCGCGGCTCACGGCGCCGATCCACGCGCATTTCGGGGTGGAG
GATCCGCGGGTCAGCCTCGATGAGGCGCAGGCCTGGGCGGACCACACGACCGGTCACTTC
GAGCTCCGGAGCCATCCGGGCGGCCACTTCTACCTCAATGACCAGGCTCCACGCGTCATC
GAGGAGATCGCCCGGGTCAGTTCGTCCGTCGCTTCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [24-244]  3.09999999999998e-56 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit