close all open/close all

CDS information : Oligo_00050


close this sectionLocation

Organism
StrainATCC 31267 (=NBRC 14893)
Entry nameOligomycin
Contig
Start / Stop / Direction4,643 / 7,438 / + [in whole cluster]
4,643 / 7,438 / + [in contig]
Location4643..7438 [in whole cluster]
4643..7438 [in contig]
TypeCDS
Length2,796 bp (931 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)luxR-family transcriptional regulatory protein
Gene
Gene (GenBank)olmRI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11572948] Genome sequence of an industrial microorganism Streptomyces avermitilis: deducing the ability of producing secondary metabolites. (Proc Natl Acad Sci U S A. , 2001)
Related Reference
ACC
Q9S0N8
NITE
Aver_00010
PmId
[10449723] Organization of the biosynthetic gene cluster for the polyketide anthelmintic macrolide avermectin in Streptomyces avermitilis. (Proc Natl Acad Sci U S A. , 1999)
[19148632] Characterization of a regulatory gene, aveR, for the biosynthesis of avermectin in Streptomyces avermitilis. (Appl Microbiol Biotechnol. , 2009)
[20012992] The pathway-specific regulator AveR from Streptomyces avermitilis positively regulates avermectin production while it negatively affects oligomycin biosynthesis. (Mol Genet Genomics. , 2010)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [luxR-family transcriptional regulatory protein]
MLIGRGQEIDRLRAAYSSVRSTGRSRAVLVESAAGCGKSEILEDLVRHVESLGLIALRAT
AIAEERNTPLSVLRSLVNGAPFPDDLVRRFHTMSDAAARMISTEGRDKARRDAAWYELMR
TFCTEVRALAQRAPLVVAVDDIHHGDADSLRQLLHLARHCRNVPVLLTFTQSLAGGPADR
TFGAELLRQPNLEHIRLPRFCRQDIADMLAEQGRADAGQGTVERYFAVSGGNPLLLRALL
EDARLEPDDTVDAQDVGPRAGQAYGRAVLACLDRGGEKAHEVAAGLAVLGGAFTHELLSR
LLDISAAALTENLRALRAAGIVVGTSFQHPAAKAAVLDSLEPSHRLRLHQRSAALLHASG
APAALAAEHLHEAGQADGAWAVGVLQQAAEQALLADEARRAVSYLELAHAASADPRGRTE
IKIRLGSVTRRVSAADAERHVDDALRGFGAGLLTPSDTGGLAALLLAHGRLEQARSVLEQ
GRRPGDGDADRTAARRQLAEIRDSVLNRGAWCAGTRAAWHENPAGRPSTGRAGTGLRAWL
SGSHAALLAQRIAGTEGLLEITHLTDATFDLVLNAVWTLLALGAVERALHWCDTFLREAK
RRDAPGWEAVFAAVRAEGALRGGNLAEAERDARRCFAVLPERHRSALEGSAVSYLVTVQI
ARGKYEDAARQLSRPMADSLPDTIHWLDYLRARGLYYMATRQYHSALRDFHEVGRLAERW
GTDWPALLPWRTDTAEALLRLGEREQGLRLATEQLAMVQDGAPRIKGISLRLQGLASEPA
ARLGLLNRAVVELSRADDRLELSRTLFDLADAHRETRQTRQAAMVLRRARQLAKSCGAQP
PRDRIGSPDAAGASGELFGEGPERNADWGHLSESERRVAGLAASGYTNREISVRLYITMS
TVEQHLTRVYRKLKINGREELLAEARAGVQV
selected fasta
>putative LuxR family transcriptional regulator [luxR-family transcriptional regulatory protein]
GTGCTGATTGGGCGAGGTCAAGAAATAGATCGACTGCGCGCGGCCTATTCTTCAGTTCGT
TCCACCGGTAGATCACGGGCCGTACTCGTCGAGTCGGCGGCCGGGTGCGGCAAGAGCGAG
ATCCTGGAGGATCTCGTACGGCATGTGGAATCGCTCGGCCTGATCGCTCTGCGCGCCACG
GCGATCGCCGAGGAACGAAACACCCCGCTGAGTGTGCTCCGGAGTCTGGTCAACGGGGCT
CCTTTCCCGGACGACCTCGTGCGGCGCTTTCACACGATGAGCGACGCGGCGGCCCGGATG
ATTTCCACGGAGGGCCGGGACAAGGCACGCCGCGACGCCGCCTGGTACGAACTGATGCGG
ACCTTCTGTACCGAGGTCCGCGCCCTCGCCCAGCGGGCGCCCCTGGTGGTGGCCGTCGAC
GACATCCACCACGGGGACGCCGACTCCCTTCGCCAGCTGCTCCATCTGGCCCGGCACTGC
CGCAACGTGCCGGTGCTGCTGACGTTCACGCAGTCGCTCGCCGGCGGTCCGGCGGACCGG
ACCTTCGGCGCGGAACTGCTGAGGCAGCCGAACCTCGAACACATACGGCTGCCGAGGTTC
TGTCGTCAGGACATCGCCGACATGCTGGCCGAGCAGGGACGCGCGGACGCCGGTCAGGGC
ACGGTGGAGCGCTACTTCGCGGTCAGCGGCGGCAATCCGCTGCTGCTGCGAGCCCTCCTG
GAGGACGCCCGCCTCGAGCCCGACGACACCGTCGACGCCCAGGACGTGGGGCCCCGGGCC
GGGCAGGCGTACGGCCGCGCGGTCCTCGCCTGTCTGGACCGCGGCGGAGAGAAGGCACAC
GAGGTCGCCGCCGGACTCGCCGTGCTGGGCGGGGCGTTCACCCATGAACTGCTCTCCCGC
TTACTCGACATCTCCGCCGCGGCGCTCACCGAGAACCTGCGCGCGCTGCGGGCCGCCGGC
ATCGTGGTCGGCACGTCCTTCCAGCACCCGGCGGCCAAGGCCGCGGTCCTGGACTCCCTG
GAGCCGTCGCACCGCCTCCGGCTGCACCAGCGGTCCGCGGCGTTGCTGCACGCCTCCGGC
GCACCGGCGGCCCTGGCGGCCGAACACCTCCACGAGGCCGGACAGGCCGACGGCGCCTGG
GCGGTGGGCGTGCTCCAGCAGGCCGCCGAACAGGCCCTGCTGGCGGACGAGGCACGGCGG
GCCGTGTCGTACCTCGAACTCGCCCACGCCGCGAGCGCGGACCCGCGGGGCCGTACCGAG
ATCAAGATCAGGCTCGGCTCCGTCACGCGCCGGGTCAGCGCGGCCGACGCCGAACGCCAT
GTGGACGACGCGCTGCGGGGGTTCGGGGCCGGCCTGCTCACCCCGTCGGACACGGGCGGC
CTCGCCGCGCTGCTGCTGGCCCACGGACGGCTGGAACAGGCGCGCTCGGTGCTGGAGCAG
GGACGGCGGCCGGGCGACGGCGACGCCGACCGCACAGCCGCGCGGCGACAGCTCGCCGAG
ATCCGCGACAGCGTGCTGAACCGGGGCGCGTGGTGCGCGGGCACCCGGGCCGCCTGGCAC
GAGAACCCCGCCGGGCGGCCGTCGACGGGCCGGGCGGGCACCGGCCTGCGCGCCTGGCTC
AGTGGGTCGCACGCCGCGCTGCTGGCCCAGCGCATCGCGGGCACCGAGGGCCTGCTGGAG
ATCACACACCTGACCGACGCCACGTTCGACCTGGTACTCAACGCGGTCTGGACGCTGCTC
GCGCTCGGCGCCGTCGAGCGGGCCCTGCACTGGTGCGACACGTTCCTGCGAGAGGCGAAG
CGGCGCGACGCGCCGGGCTGGGAGGCGGTCTTCGCGGCCGTACGCGCCGAGGGGGCCCTG
CGCGGCGGCAATCTGGCCGAGGCGGAGCGGGACGCCCGCCGCTGTTTCGCGGTCCTGCCG
GAACGGCACCGGTCGGCCCTGGAGGGCAGCGCGGTCTCGTACCTGGTGACGGTCCAGATC
GCGCGGGGCAAGTACGAGGACGCGGCACGGCAGTTGAGCCGGCCCATGGCGGACTCGCTG
CCCGACACCATCCACTGGCTCGACTATCTGCGGGCCCGCGGGCTCTACTACATGGCCACC
CGGCAGTACCACTCGGCGCTGCGTGACTTCCACGAGGTGGGCCGCCTCGCCGAGCGGTGG
GGCACGGACTGGCCCGCCCTGCTGCCCTGGCGCACGGACACGGCCGAGGCGCTGCTGCGC
CTCGGGGAGCGGGAGCAGGGGCTGCGGCTGGCCACCGAGCAGCTGGCCATGGTGCAGGAC
GGCGCCCCGCGCATCAAGGGCATCTCACTGCGCCTCCAGGGGCTCGCGTCGGAGCCCGCC
GCCCGGCTCGGGCTGCTCAACCGGGCCGTCGTGGAGCTGAGCCGCGCGGACGACCGGCTG
GAGCTCTCGCGCACCCTGTTCGACCTGGCCGACGCCCACCGGGAGACCCGGCAGACCCGG
CAGGCGGCGATGGTCCTGCGCCGGGCGCGGCAACTGGCGAAGAGCTGCGGGGCGCAGCCG
CCCCGGGACCGGATCGGTTCGCCCGACGCCGCGGGGGCGTCGGGGGAACTCTTCGGCGAG
GGACCCGAACGGAACGCCGACTGGGGACATCTCAGCGAGTCCGAACGCCGGGTCGCCGGC
CTGGCCGCCAGCGGATATACGAACCGTGAGATCTCGGTAAGACTCTACATAACCATGAGT
ACGGTGGAGCAACACCTTACCCGAGTTTACCGAAAGCTAAAGATAAACGGACGTGAGGAA
TTGCTGGCCGAAGCCCGCGCGGGTGTGCAGGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [871-885]  1.9000006847787e-08 PR00038 [885-901]  1.9000006847787e-08 PR00038 [901-913]  1.9000006847787e-08 PR00038
PR00038   HTHLUXR
 [864-929]  PS50043
PS50043   HTH_LUXR_2
 [868-925]  2.49999811956465e-21 SM00421
SM00421   HTH_LUXR
 [885-912]  PS00622
PS00622   HTH_LUXR_1
 [871-924]  1.7e-11 PF00196
PF00196   GerE
IPR011990 Tetratricopeptide-like helical (Domain)
 [577-756]  1.8e-14 G3DSA:1.25.40.10 [792-879]  1.8e-14 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [880-926]  3.5e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [849-927]  3.00000067992871e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit